5OW5ACEF

P60p80-camsap complex
A: 605-609 C: 605-609,639-644
Link type Probability Loop ranges Chain A piercings Chain C piercings Chain E piercings Chain F piercings
view details
Other Other 41% -A -566C +578C -630C +648C -658C -657E -18F -18F -18F
view details
Other Other 41% -A -566C +578C -630C +648C -658C -657E -18F -18F -18F
view details
Other Other 41% -A -566C +578C -630C +648C -658C -657E -18F -18F -18F
view details
Other Other 41% -A -566C +578C -630C +648C -658C -657E -18F -18F -18F
view details
Other Other 41% -A -566C +578C -630C +648C -658C -657E -18F -18F -18F
view details
Other Other 41% -A -566C +578C -630C +648C -658C -657E -18F -18F -18F
view details
Other Other 41% -A -566C +578C -630C +648C -658C -657E -18F -18F -18F
view details
Other Other 41% -A -566C +578C -630C +648C -658C -657E -18F -18F -18F
view details
Other Other 41% -A -566C +578C -630C +648C -658C -657E -18F -18F -18F
view details
Other Other 41% -A -566C +578C -630C +648C -658C -657E -18F -18F -18F
view details
Other Other 41% -A -566C +578C -630C +648C -658C -657E -18F -18F -18F
view details
Other Other 41% -A -566C +578C -630C +648C -658C -657E -18F -18F -18F
view details
Other Other 41% -A -566C +578C -630C +648C -658C -657E -18F -18F -18F
view details
Other Other 41% -A -566C +578C -630C +648C -658C -657E -18F -18F -18F
view details
Other Other 41% -A -566C +578C -630C +648C -658C -657E -18F -18F -18F
view details
Other Other 41% -A -566C +578C -630C +648C -658C -657E -18F -18F -18F
view details
Other Other 41% -A -566C +578C -630C +648C -658C -657E -18F -18F -18F
view details
Other Other 41% -A -566C +578C -630C +648C -658C -657E -18F -18F -18F
view details
Other Other 41% -A -566C +578C -630C +648C -658C -657E -18F -18F -18F
view details
Other Other 41% -A -566C +578C -630C +648C -658C -657E -18F -18F -18F
view details
Other Other 41% -A -566C +578C -630C +648C -658C -657E -18F -18F -18F
view details
Other Other 41% -A -566C +578C -630C +648C -658C -657E -18F -18F -18F
view details
Other Other 41% -A -566C +578C -630C +648C -658C -657E -18F -18F -18F
view details
Other Other 41% -A -566C +578C -630C +648C -658C -657E -18F -18F -18F
view details
Other Other 41% -A -566C +578C -630C +648C -658C -657E -18F -18F -18F
Interpreting sequences
Chain A Sequence
LVDEDAMSQIRKGHDTMFVVLTSRHKNLDTVRAVWTTGDIKTSVDSAVAINDLSVVVDLLNIVNQKASLWKLDLCTTVLPQIEKLLQSKYESYVQTGCTSLKLILQRFLPLITDILAAPPS---DISREERLHKCRLCFKQLKSISGLVKSKSGLSGRHGSAFRELHLLMASL
Chain A Sequence
VDEDAMSQIRKGHDTMFVVLTSRHKNLDTVRAVWTTGDIKTSVDSAVAINDLSVVVDLLNIVNQKASLWKLDLCTTVLPQIEKLLQSKYESYVQTGCTSLKLILQRFLPLITDILAAPPS---DISREERLHKCRLCFKQLKSISGLVKSKSGL----GSAFRELHLLMASL
Chain A Sequence
IEEALQIIHS
Chain A Sequence
IEEALQIIHS
sequence length 173,172,10,10
structure length 170,165,10,10
publication title Structural Basis of Formation of the Microtubule Minus-End-Regulating CAMSAP-Katanin Complex.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Katanin p80 WD40 repeat-containing subunit B1
source organism Mus musculus
missing residues A: 605-609 C: 605-609,639-644
pdb deposition date2017-08-30
LinkProt deposition date2018-07-13
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling