5OTUABCD

Extracellular domain of glp-1 receptor in complex with glp-1 variant ala8hcs/thr11hcs
Link type Probability Loop ranges Chain A piercings Chain B piercings Chain C piercings Chain D piercings
view details
Other Other 34% -A +35B +68C -128D -93A -129A -36B
view details
Other Other 34% -A +35B +68C -128D -93A -129A -36B
view details
Other Other 34% -A +35B +68C -128D -93A -129A -36B
view details
Other Other 34% -A +35B +68C -128D -93A -129A -36B
view details
Other Other 34% -A +35B +68C -128D -93A -129A -36B
view details
Other Other 34% -A +35B +68C -128D -93A -129A -36B
view details
Other Other 34% -A +35B +68C -128D -93A -129A -36B
view details
Other Other 34% -A +35B +68C -128D -93A -129A -36B
view details
Other Other 34% -A +35B +68C -128D -93A -129A -36B
view details
Other Other 34% -A +35B +68C -128D -93A -129A -36B
view details
Other Other 34% -A +35B +68C -128D -93A -129A -36B
view details
Other Other 34% -A +35B +68C -128D -93A -129A -36B
view details
Other Other 34% -A +35B +68C -128D -93A -129A -36B
view details
Other Other 34% -A +35B +68C -128D -93A -129A -36B
view details
Other Other 34% -A +35B +68C -128D -93A -129A -36B
view details
Other Other 34% -A +35B +68C -128D -93A -129A -36B
view details
Other Other 34% -A +35B +68C -128D -93A -129A -36B
view details
Other Other 34% -A +35B +68C -128D -93A -129A -36B
view details
Other Other 34% -A +35B +68C -128D -93A -129A -36B
view details
Other Other 34% -A +35B +68C -128D -93A -129A -36B
view details
Other Other 34% -A +35B +68C -128D -93A -129A -36B
view details
Other Other 34% -A +35B +68C -128D -93A -129A -36B
view details
Other Other 34% -A +35B +68C -128D -93A -129A -36B
view details
Other Other 34% -A +35B +68C -128D -93A -129A -36B
view details
Other Other 34% -A +35B +68C -128D -93A -129A -36B
view details
Other Other 34% -A +35B +68C -128D -93A -129A -36B
view details
Other Other 34% -A +35B +68C -128D -93A -129A -36B
view details
Other Other 34% -A +35B +68C -128D -93A -129A -36B
view details
Other Other 34% -A +35B +68C -128D -93A -129A -36B
Interpreting sequences
Chain A Sequence
TVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEE
Chain A Sequence
HEGFTSDVSSYLEGQAAKEFIAWLVKG
Chain A Sequence
TVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEE
Chain A Sequence
EGFTSDVSSYLEGQAAKEFIAWLVKG
sequence length 100,29,100,27
structure length 100,27,100,26
publication title alpha-Helix or beta-Turn? An Investigation into N-Terminally Constrained Analogues of Glucagon-like Peptide 1 (GLP-1) and Exendin-4.
pubmed doi rcsb
molecule tags Signaling protein
molecule keywords Glucagon-like peptide 1 receptor
source organism Homo sapiens
pdb deposition date2017-08-22
LinkProt deposition date2018-07-07
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling