| Link type | Probability | Loop ranges | Chain A piercings | Chain B piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Unlink | 49% | -A | +133B -175B | |||||||||
| view details |
|
Unlink | 49% | -A | +133B -175B | |||||||||
| view details |
|
Unlink | 49% | -A | +133B -175B | |||||||||
| view details |
|
Unlink | 49% | -A | +133B -175B | |||||||||
| view details |
|
Unlink | 49% | -A | +133B -175B | |||||||||
| view details |
|
Unlink | 49% | -A | +133B -175B | |||||||||
Chain A Sequence |
MIEIIRSKEFSLKPMDSEEAVLQMNLLGHDFFVFTDRETDGTSIVYRRKDGKYGLIQTS |
Chain A Sequence |
MIEIIRSKEFSLKPMDSEAVLQMNLLGHDFFVFTDRETDGTSIVYRRKDGKYGLIQTS |
| sequence length | 59,59 |
| structure length | 59,58 |
| publication title |
Structural and functional analysis of the C-terminal domain of Staphylococcus aureus Hibernation Promoting Factor (SaHPF)
rcsb |
| molecule tags | Ribosomal protein |
| molecule keywords | Ribosome hibernation promoting factor |
| source organism | Staphylococcus aureus |
| pdb deposition date | 2017-08-09 |
| LinkProt deposition date | 2018-07-20 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
