5ODCGJKL

Heterodisulfide reductase / [nife]-hydrogenase complex from methanothermococcus thermolithotrophicus at 2.3 a resolution
Link type Probability Loop ranges Chain G piercings Chain J piercings Chain K piercings Chain L piercings
view details
Other Other 34% -G -93L +281L -4G +43G +127G -646G +49K -81K +367K +654L +299G +6J +272L -402L
view details
Other Other 34% -G -93L +281L -4G +43G +127G -646G +49K -81K +367K +654L +299G +6J +272L -402L
view details
Other Other 34% -G -93L +281L -4G +43G +127G -646G +49K -81K +367K +654L +299G +6J +272L -402L
view details
Other Other 34% -G -93L +281L -4G +43G +127G -646G +49K -81K +367K +654L +299G +6J +272L -402L
view details
Other Other 34% -G -93L +281L -4G +43G +127G -646G +49K -81K +367K +654L +299G +6J +272L -402L
view details
Other Other 34% -G -93L +281L -4G +43G +127G -646G +49K -81K +367K +654L +299G +6J +272L -402L
view details
Other Other 34% -G -93L +281L -4G +43G +127G -646G +49K -81K +367K +654L +299G +6J +272L -402L
view details
Other Other 34% -G -93L +281L -4G +43G +127G -646G +49K -81K +367K +654L +299G +6J +272L -402L
view details
Other Other 34% -G -93L +281L -4G +43G +127G -646G +49K -81K +367K +654L +299G +6J +272L -402L
view details
Other Other 34% -G -93L +281L -4G +43G +127G -646G +49K -81K +367K +654L +299G +6J +272L -402L
view details
Other Other 34% -G -93L +281L -4G +43G +127G -646G +49K -81K +367K +654L +299G +6J +272L -402L
view details
Other Other 34% -G -93L +281L -4G +43G +127G -646G +49K -81K +367K +654L +299G +6J +272L -402L
view details
Other Other 34% -G -93L +281L -4G +43G +127G -646G +49K -81K +367K +654L +299G +6J +272L -402L
view details
Other Other 34% -G -93L +281L -4G +43G +127G -646G +49K -81K +367K +654L +299G +6J +272L -402L
view details
Other Other 34% -G -93L +281L -4G +43G +127G -646G +49K -81K +367K +654L +299G +6J +272L -402L
view details
Other Other 34% -G -93L +281L -4G +43G +127G -646G +49K -81K +367K +654L +299G +6J +272L -402L
view details
Other Other 34% -G -93L +281L -4G +43G +127G -646G +49K -81K +367K +654L +299G +6J +272L -402L
view details
Other Other 34% -G -93L +281L -4G +43G +127G -646G +49K -81K +367K +654L +299G +6J +272L -402L
view details
Other Other 34% -G -93L +281L -4G +43G +127G -646G +49K -81K +367K +654L +299G +6J +272L -402L
view details
Other Other 34% -G -93L +281L -4G +43G +127G -646G +49K -81K +367K +654L +299G +6J +272L -402L
view details
Other Other 34% -G -93L +281L -4G +43G +127G -646G +49K -81K +367K +654L +299G +6J +272L -402L
view details
Other Other 34% -G -93L +281L -4G +43G +127G -646G +49K -81K +367K +654L +299G +6J +272L -402L
view details
Other Other 34% -G -93L +281L -4G +43G +127G -646G +49K -81K +367K +654L +299G +6J +272L -402L
view details
Other Other 34% -G -93L +281L -4G +43G +127G -646G +49K -81K +367K +654L +299G +6J +272L -402L
view details
Other Other 34% -G -93L +281L -4G +43G +127G -646G +49K -81K +367K +654L +299G +6J +272L -402L
view details
Other Other 34% -G -93L +281L -4G +43G +127G -646G +49K -81K +367K +654L +299G +6J +272L -402L
view details
Other Other 34% -G -93L +281L -4G +43G +127G -646G +49K -81K +367K +654L +299G +6J +272L -402L
view details
Other Other 34% -G -93L +281L -4G +43G +127G -646G +49K -81K +367K +654L +299G +6J +272L -402L
view details
Other Other 34% -G -93L +281L -4G +43G +127G -646G +49K -81K +367K +654L +299G +6J +272L -402L
view details
Other Other 34% -G -93L +281L -4G +43G +127G -646G +49K -81K +367K +654L +299G +6J +272L -402L
view details
Other Other 34% -G -93L +281L -4G +43G +127G -646G +49K -81K +367K +654L +299G +6J +272L -402L
view details
Other Other 34% -G -93L +281L -4G +43G +127G -646G +49K -81K +367K +654L +299G +6J +272L -402L
view details
Other Other 34% -G -93L +281L -4G +43G +127G -646G +49K -81K +367K +654L +299G +6J +272L -402L
view details
Other Other 34% -G -93L +281L -4G +43G +127G -646G +49K -81K +367K +654L +299G +6J +272L -402L
view details
Other Other 34% -G -93L +281L -4G +43G +127G -646G +49K -81K +367K +654L +299G +6J +272L -402L
view details
Other Other 34% -G -93L +281L -4G +43G +127G -646G +49K -81K +367K +654L +299G +6J +272L -402L
view details
Other Other 34% -G -93L +281L -4G +43G +127G -646G +49K -81K +367K +654L +299G +6J +272L -402L
view details
Other Other 34% -G -93L +281L -4G +43G +127G -646G +49K -81K +367K +654L +299G +6J +272L -402L
view details
Other Other 34% -G -93L +281L -4G +43G +127G -646G +49K -81K +367K +654L +299G +6J +272L -402L
view details
Other Other 34% -G -93L +281L -4G +43G +127G -646G +49K -81K +367K +654L +299G +6J +272L -402L
view details
Other Other 34% -G -93L +281L -4G +43G +127G -646G +49K -81K +367K +654L +299G +6J +272L -402L
view details
Other Other 34% -G -93L +281L -4G +43G +127G -646G +49K -81K +367K +654L +299G +6J +272L -402L
view details
Other Other 34% -G -93L +281L -4G +43G +127G -646G +49K -81K +367K +654L +299G +6J +272L -402L
view details
Other Other 34% -G -93L +281L -4G +43G +127G -646G +49K -81K +367K +654L +299G +6J +272L -402L
view details
Other Other 34% -G -93L +281L -4G +43G +127G -646G +49K -81K +367K +654L +299G +6J +272L -402L
view details
Other Other 34% -G -93L +281L -4G +43G +127G -646G +49K -81K +367K +654L +299G +6J +272L -402L
view details
Other Other 34% -G -93L +281L -4G +43G +127G -646G +49K -81K +367K +654L +299G +6J +272L -402L
view details
Other Other 34% -G -93L +281L -4G +43G +127G -646G +49K -81K +367K +654L +299G +6J +272L -402L
view details
Other Other 34% -G -93L +281L -4G +43G +127G -646G +49K -81K +367K +654L +299G +6J +272L -402L
view details
Other Other 34% -G -93L +281L -4G +43G +127G -646G +49K -81K +367K +654L +299G +6J +272L -402L
view details
Other Other 34% -G -93L +281L -4G +43G +127G -646G +49K -81K +367K +654L +299G +6J +272L -402L
view details
Other Other 34% -G -93L +281L -4G +43G +127G -646G +49K -81K +367K +654L +299G +6J +272L -402L
view details
Other Other 34% -G -93L +281L -4G +43G +127G -646G +49K -81K +367K +654L +299G +6J +272L -402L
Interpreting sequences
Chain G Sequence
EEPRIGVYVCHCGVNIGGTVDCPDVTEFAKTLKNVVVARDYKYMCADPGQEMIKKDIKEHNLNRVVVAACSPRLHEPTFRRCVAEAGLNPFLFEFANIREHCSWVHMHEKEKATEKAKDLVRMAVAKARLLEPLEFIKVGVTQRALVIGGGVAGIQTALDLGDMGFETILVEKTPSVGGRMAQLDKTFPTNDCSICILAPKMVDVAKHPNVKLYAYSEVVDVQGYVGNFKVKIMKKARYIDETKCTGCGQCSEVCPIDVPNEFDMGIGMRKAIYKPFPQAVPAKYTIDKEHCIECGLCAKVCGPNAIDFDQEPEIIEAEVGTIICAIGYDAFDPTVREEYGYGVYDNVVTALELERMINASGPTGGKVIRLSDGQKPKRIAFIQCVGSRDAKVGNKYCSNVCCMYAMKNSQLIKEKSPDTEIDIYYMDIRAFSKGYEEFYERSAKQYGIKFMRGRPSQVIEDPETGNLVVRAEDTLLGEILEKEYDLVVLSVGMVPTKSADEVQKILGISRTPDQFFMEAHPKLRPVDTATDGVYLAGACQGPKDIPASVAQGSAAASRAAIPLAKGEVEVEPIIASVDAEICGGCGVCVKQCPYGAPRLVEKDGKVVAEVISALCKGCGTCPAGCPSGALEQDHFKTIQLFKQIEGMFRDTA
Chain G Sequence
EWEPKIIGFCCNWCTYGGADTAGVGRMQYPPSIRIIRVMCSGRIEPSLILKAFKEGADGVFVGGCHLGDCHYDSGNYKWQRRVMMLYELLEELGIEKERLNHEWISASEGEKFQNTMKDFYNKIEALGPCKLKEELDK
Chain G Sequence
VKIATTWLGGCSGCHISLLDLHEELLNLLENVELVHCPVLMDVKEIPDEVEVALIEGGIRNEENLEIAKEMRERAKIVIAFGTCAAFGGVPGLGNLYSNDELLDKAYKTTITTKNDDGIIPNEEVPELVSRVKPLSEVIEVDYFIPGCPPNPEMIAEVVKALLEGKEPELPKKNLCEECARKKSEEGVAIETIKRNYEGNPDPEKCLLEQGYICLGIATREGCGAPCPSSGVPCSGCSGPTDAVVDQGAKMISALCSDFGIDNDRDVDPMILPKSIKDKIGSFYKFTLPSAFVPIRLK
Chain G Sequence
VKLSVEPVTRVEGHGKISVSFDDSGNLDKVRFHVVEVRGFEKFLEGRYVEDAPIYTPRICGICQVAHHLASAKAVDNVFGVKIPETAELLRNLMHQGATVHSHALHFYMLAAPDLMFPTTDDVLKRNLMGIAKEHPEIIKDAIELRKAGQNVVRVVGGRAIHPVTAVVGGQSKSLKEEERDELLKLSERTIELSEKSIEVGKKLLENIKDEDLLDIGYFESAHMGMVNNGVHDLYDGKLRVVNSEGKVEYEFDPSEYMNYIAEGVKPYSYLKFPYLKDKGEEDGIYRVNTLSRLNVSDKMATPLAQKYYDEFVKEFGKPCHHPMLFHYARLIELLSSAEMVKELLENDKIVGEDIRAEPEEVVGDGVGCVEAPRGTLIHHFKTDDDGIITDTNLVVATVQNNPAMDIGVRKVAEKYIKAPEDATPQVLNYMEMLIRAYDPCLSCATH
sequence length 653,138,298,447
structure length 653,138,298,447
publication title Methanogenic heterodisulfide reductase (HdrABC-MvhAGD) uses two noncubane [4Fe-4S] clusters for reduction.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Heterodisulfide reductase, subunit A
pdb deposition date2017-07-05
LinkProt deposition date2017-09-02
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling