5ODCDFHI

Heterodisulfide reductase / [nife]-hydrogenase complex from methanothermococcus thermolithotrophicus at 2.3 a resolution
Link type Probability Loop ranges Chain D piercings Chain F piercings Chain H piercings Chain I piercings
view details
Other Other 31% -D -50D -100D -292D -448F -448F -448F -109I
view details
Other Other 31% -D -50D -100D -292D -448F -448F -448F -109I
view details
Other Other 31% -D -50D -100D -292D -448F -448F -448F -109I
view details
Other Other 31% -D -50D -100D -292D -448F -448F -448F -109I
view details
Other Other 31% -D -50D -100D -292D -448F -448F -448F -109I
view details
Other Other 31% -D -50D -100D -292D -448F -448F -448F -109I
view details
Other Other 31% -D -50D -100D -292D -448F -448F -448F -109I
view details
Other Other 31% -D -50D -100D -292D -448F -448F -448F -109I
view details
Other Other 31% -D -50D -100D -292D -448F -448F -448F -109I
view details
Other Other 31% -D -50D -100D -292D -448F -448F -448F -109I
view details
Other Other 31% -D -50D -100D -292D -448F -448F -448F -109I
view details
Other Other 31% -D -50D -100D -292D -448F -448F -448F -109I
view details
Other Other 31% -D -50D -100D -292D -448F -448F -448F -109I
view details
Other Other 31% -D -50D -100D -292D -448F -448F -448F -109I
view details
Other Other 31% -D -50D -100D -292D -448F -448F -448F -109I
view details
Other Other 31% -D -50D -100D -292D -448F -448F -448F -109I
view details
Other Other 31% -D -50D -100D -292D -448F -448F -448F -109I
view details
Other Other 31% -D -50D -100D -292D -448F -448F -448F -109I
view details
Other Other 31% -D -50D -100D -292D -448F -448F -448F -109I
view details
Other Other 31% -D -50D -100D -292D -448F -448F -448F -109I
view details
Other Other 31% -D -50D -100D -292D -448F -448F -448F -109I
view details
Other Other 31% -D -50D -100D -292D -448F -448F -448F -109I
view details
Other Other 31% -D -50D -100D -292D -448F -448F -448F -109I
view details
Other Other 31% -D -50D -100D -292D -448F -448F -448F -109I
view details
Other Other 31% -D -50D -100D -292D -448F -448F -448F -109I
view details
Other Other 31% -D -50D -100D -292D -448F -448F -448F -109I
view details
Other Other 31% -D -50D -100D -292D -448F -448F -448F -109I
view details
Other Other 31% -D -50D -100D -292D -448F -448F -448F -109I
view details
Other Other 31% -D -50D -100D -292D -448F -448F -448F -109I
view details
Other Other 31% -D -50D -100D -292D -448F -448F -448F -109I
view details
Other Other 31% -D -50D -100D -292D -448F -448F -448F -109I
view details
Other Other 31% -D -50D -100D -292D -448F -448F -448F -109I
view details
Other Other 31% -D -50D -100D -292D -448F -448F -448F -109I
view details
Other Other 31% -D -50D -100D -292D -448F -448F -448F -109I
view details
Other Other 31% -D -50D -100D -292D -448F -448F -448F -109I
view details
Other Other 31% -D -50D -100D -292D -448F -448F -448F -109I
view details
Other Other 31% -D -50D -100D -292D -448F -448F -448F -109I
view details
Other Other 31% -D -50D -100D -292D -448F -448F -448F -109I
view details
Other Other 31% -D -50D -100D -292D -448F -448F -448F -109I
Interpreting sequences
Chain D Sequence
EWEPKIIGFCCNWCTYGGADTAGVGRMQYPPSIRIIRVMCSGRIEPSLILKAFKEGADGVFVGGCHLGDCHYDSGNYKWQRRVMMLYELLEELGIEKERLNHEWISASEGEKFQNTMKDFYNKIEALGPCKLKEELDK
Chain D Sequence
VKLSVEPVTRVEGHGKISVSFDDSGNLDKVRFHVVEVRGFEKFLEGRYVEDAPIYTPRICGICQVAHHLASAKAVDNVFGVKIPETAELLRNLMHQGATVHSHALHFYMLAAPDLMFPTTDDVLKRNLMGIAKEHPEIIKDAIELRKAGQNVVRVVGGRAIHPVTAVVGGQSKSLKEEERDELLKLSERTIELSEKSIEVGKKLLENIKDEDLLDIGYFESAHMGMVNNGVHDLYDGKLRVVNSEGKVEYEFDPSEYMNYIAEGVKPYSYLKFPYLKDKGEEDGIYRVNTLSRLNVSDKMATPLAQKYYDEFVKEFGKPCHHPMLFHYARLIELLSSAEMVKELLENDKIVGEDIRAEPEEVVGDGVGCVEAPRGTLIHHFKTDDDGIITDTNLVVATVQNNPAMDIGVRKVAEKYIKAPEDATPQVLNYMEMLIRAYDPCLSCATH
Chain D Sequence
MKYAFFLGCIMPNRYAGVEAATRTVMEKLGVELVDMTGASCCPAPGVFGSFDQKTWLTLAARNLCIAEEMGVDIVTVCNGCYGSLFEAAHLLHDNKEALNFVNEKLDKVGKEYKGNVKVRHFAELIYNDIGVDKIAEKVERPLNINVGVHYGCHFLKPTDVKHLGSAERPVMLDEIVEATGAKSVPYADKMMCCGAGGGVRARELELSLDMTNEKIENMIKAGADCTVNVCPFCHLQFDRGQIEIKEKFGKEYNFPVLHLSQLLGLAMGMDPKDLALSVHQISVDPLLKKI
Chain D Sequence
MIYSSDLNKNLASQIIEAGTPIPGDDVVSSLKACYQCGTCTGSCPSGRRTSYRTRKVIRKALLGMDDVLDSDDIWKCTTCYTCYERCPRDVKVTEIIKTIRNLAAQKGNMAKAHKMTAMYVLKYGHAVPANKNTAELRKSIGLSEKAPIAQFSEKDLNEMNTLIKELGFDELI
sequence length 138,447,291,173
structure length 138,447,291,173
publication title Methanogenic heterodisulfide reductase (HdrABC-MvhAGD) uses two noncubane [4Fe-4S] clusters for reduction.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Heterodisulfide reductase, subunit A
pdb deposition date2017-07-05
LinkProt deposition date2017-09-02
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling