| Link type | Probability | Loop ranges | Chain A piercings | Chain F piercings | Chain H piercings | Chain I piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
|
Other | 30% | -A | -45F -280F -447F -654H -654H -655H | |||||||||||
| view details |
|
Other | 30% | -A | -45F -280F -447F -654H -654H -655H | |||||||||||
| view details |
|
Other | 30% | -A | -45F -280F -447F -654H -654H -655H | |||||||||||
| view details |
|
Other | 30% | -A | -45F -280F -447F -654H -654H -655H | |||||||||||
| view details |
|
Other | 30% | -A | -45F -280F -447F -654H -654H -655H | |||||||||||
| view details |
|
Other | 30% | -A | -45F -280F -447F -654H -654H -655H | |||||||||||
| view details |
|
Other | 30% | -A | -45F -280F -447F -654H -654H -655H | |||||||||||
| view details |
|
Other | 30% | -A | -45F -280F -447F -654H -654H -655H | |||||||||||
| view details |
|
Other | 30% | -A | -45F -280F -447F -654H -654H -655H | |||||||||||
| view details |
|
Other | 30% | -A | -45F -280F -447F -654H -654H -655H | |||||||||||
| view details |
|
Other | 30% | -A | -45F -280F -447F -654H -654H -655H | |||||||||||
| view details |
|
Other | 30% | -A | -45F -280F -447F -654H -654H -655H | |||||||||||
| view details |
|
Other | 30% | -A | -45F -280F -447F -654H -654H -655H | |||||||||||
| view details |
|
Other | 30% | -A | -45F -280F -447F -654H -654H -655H | |||||||||||
| view details |
|
Other | 30% | -A | -45F -280F -447F -654H -654H -655H | |||||||||||
| view details |
|
Other | 30% | -A | -45F -280F -447F -654H -654H -655H | |||||||||||
| view details |
|
Other | 30% | -A | -45F -280F -447F -654H -654H -655H | |||||||||||
| view details |
|
Other | 30% | -A | -45F -280F -447F -654H -654H -655H | |||||||||||
| view details |
|
Other | 30% | -A | -45F -280F -447F -654H -654H -655H | |||||||||||
| view details |
|
Other | 30% | -A | -45F -280F -447F -654H -654H -655H | |||||||||||
| view details |
|
Other | 30% | -A | -45F -280F -447F -654H -654H -655H | |||||||||||
| view details |
|
Other | 30% | -A | -45F -280F -447F -654H -654H -655H | |||||||||||
| view details |
|
Other | 30% | -A | -45F -280F -447F -654H -654H -655H | |||||||||||
| view details |
|
Other | 30% | -A | -45F -280F -447F -654H -654H -655H | |||||||||||
| view details |
|
Other | 30% | -A | -45F -280F -447F -654H -654H -655H | |||||||||||
| view details |
|
Other | 30% | -A | -45F -280F -447F -654H -654H -655H | |||||||||||
| view details |
|
Other | 30% | -A | -45F -280F -447F -654H -654H -655H | |||||||||||
| view details |
|
Other | 30% | -A | -45F -280F -447F -654H -654H -655H | |||||||||||
| view details |
|
Other | 30% | -A | -45F -280F -447F -654H -654H -655H | |||||||||||
| view details |
|
Other | 30% | -A | -45F -280F -447F -654H -654H -655H | |||||||||||
| view details |
|
Other | 30% | -A | -45F -280F -447F -654H -654H -655H | |||||||||||
| view details |
|
Other | 30% | -A | -45F -280F -447F -654H -654H -655H | |||||||||||
| view details |
|
Other | 30% | -A | -45F -280F -447F -654H -654H -655H | |||||||||||
| view details |
|
Other | 30% | -A | -45F -280F -447F -654H -654H -655H | |||||||||||
| view details |
|
Other | 30% | -A | -45F -280F -447F -654H -654H -655H | |||||||||||
| view details |
|
Other | 30% | -A | -45F -280F -447F -654H -654H -655H | |||||||||||
| view details |
|
Other | 30% | -A | -45F -280F -447F -654H -654H -655H | |||||||||||
| view details |
|
Other | 30% | -A | -45F -280F -447F -654H -654H -655H | |||||||||||
| view details |
|
Other | 30% | -A | -45F -280F -447F -654H -654H -655H | |||||||||||
| view details |
|
Other | 30% | -A | -45F -280F -447F -654H -654H -655H | |||||||||||
Chain A Sequence |
EEPRIGVYVCHCGVNIGGTVDCPDVTEFAKTLKNVVVARDYKYMCADPGQEMIKKDIKEHNLNRVVVAACSPRLHEPTFRRCVAEAGLNPFLFEFANIREHCSWVHMHEKEKATEKAKDLVRMAVAKARLLEPLEFIKVGVTQRALVIGGGVAGIQTALDLGDMGFETILVEKTPSVGGRMAQLDKTFPTNDCSICILAPKMVDVAKHPNVKLYAYSEVVDVQGYVGNFKVKIMKKARYIDETKCTGCGQCSEVCPIDVPNEFDMGIGMRKAIYKPFPQAVPAKYTIDKEHCIECGLCAKVCGPNAIDFDQEPEIIEAEVGTIICAIGYDAFDPTVREEYGYGVYDNVVTALELERMINASGPTGGKVIRLSDGQKPKRIAFIQCVGSRDAKVGNKYCSNVCCMYAMKNSQLIKEKSPDTEIDIYYMDIRAFSKGYEEFYERSAKQYGIKFMRGRPSQVIEDPETGNLVVRAEDTLLGEILEKEYDLVVLSVGMVPTKSADEVQKILGISRTPDQFFMEAHPKLRPVDTATDGVYLAGACQGPKDIPASVAQGSAAASRAAIPLAKGEVEVEPIIASVDAEICGGCGVCVKQCPYGAPRLVEKDGKVVAEVISALCKGCGTCPAGCPSGALEQDHFKTIQLFKQIEGMFRDTA |
Chain A Sequence |
VKLSVEPVTRVEGHGKISVSFDDSGNLDKVRFHVVEVRGFEKFLEGRYVEDAPIYTPRICGICQVAHHLASAKAVDNVFGVKIPETAELLRNLMHQGATVHSHALHFYMLAAPDLMFPTTDDVLKRNLMGIAKEHPEIIKDAIELRKAGQNVVRVVGGRAIHPVTAVVGGQSKSLKEEERDELLKLSERTIELSEKSIEVGKKLLENIKDEDLLDIGYFESAHMGMVNNGVHDLYDGKLRVVNSEGKVEYEFDPSEYMNYIAEGVKPYSYLKFPYLKDKGEEDGIYRVNTLSRLNVSDKMATPLAQKYYDEFVKEFGKPCHHPMLFHYARLIELLSSAEMVKELLENDKIVGEDIRAEPEEVVGDGVGCVEAPRGTLIHHFKTDDDGIITDTNLVVATVQNNPAMDIGVRKVAEKYIKAPEDATPQVLNYMEMLIRAYDPCLSCATH |
Chain A Sequence |
MKYAFFLGCIMPNRYAGVEAATRTVMEKLGVELVDMTGASCCPAPGVFGSFDQKTWLTLAARNLCIAEEMGVDIVTVCNGCYGSLFEAAHLLHDNKEALNFVNEKLDKVGKEYKGNVKVRHFAELIYNDIGVDKIAEKVERPLNINVGVHYGCHFLKPTDVKHLGSAERPVMLDEIVEATGAKSVPYADKMMCCGAGGGVRARELELSLDMTNEKIENMIKAGADCTVNVCPFCHLQFDRGQIEIKEKFGKEYNFPVLHLSQLLGLAMGMDPKDLALSVHQISVDPLLKKI |
Chain A Sequence |
MIYSSDLNKNLASQIIEAGTPIPGDDVVSSLKACYQCGTCTGSCPSGRRTSYRTRKVIRKALLGMDDVLDSDDIWKCTTCYTCYERCPRDVKVTEIIKTIRNLAAQKGNMAKAHKMTAMYVLKYGHAVPANKNTAELRKSIGLSEKAPIAQFSEKDLNEMNTLIKELGFDELI |
| sequence length | 653,447,291,173 |
| structure length | 653,447,291,173 |
| publication title |
Methanogenic heterodisulfide reductase (HdrABC-MvhAGD) uses two noncubane [4Fe-4S] clusters for reduction.
pubmed doi rcsb |
| molecule tags | Oxidoreductase |
| molecule keywords | Heterodisulfide reductase, subunit A |
| pdb deposition date | 2017-07-05 |
| LinkProt deposition date | 2017-09-02 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...