5O6YABCD

Crystal structure of the bc1960 peptidoglycan n-acetylglucosamine deacetylase in complex with 4-naphthalen-1-yl-~{n}-oxidanyl-benzamide
Link type Probability Loop ranges Chain A piercings Chain B piercings Chain C piercings Chain D piercings
view details
Other Other 46% -A -267C -124D -267A -266B
view details
Other Other 46% -A -267C -124D -267A -266B
view details
Other Other 46% -A -267C -124D -267A -266B
view details
Other Other 46% -A -267C -124D -267A -266B
view details
Other Other 46% -A -267C -124D -267A -266B
view details
Other Other 46% -A -267C -124D -267A -266B
view details
Other Other 46% -A -267C -124D -267A -266B
view details
Other Other 46% -A -267C -124D -267A -266B
view details
Other Other 46% -A -267C -124D -267A -266B
view details
Other Other 46% -A -267C -124D -267A -266B
view details
Other Other 46% -A -267C -124D -267A -266B
view details
Other Other 46% -A -267C -124D -267A -266B
view details
Other Other 46% -A -267C -124D -267A -266B
view details
Other Other 46% -A -267C -124D -267A -266B
view details
Other Other 46% -A -267C -124D -267A -266B
view details
Other Other 46% -A -267C -124D -267A -266B
view details
Other Other 46% -A -267C -124D -267A -266B
view details
Other Other 46% -A -267C -124D -267A -266B
view details
Other Other 46% -A -267C -124D -267A -266B
view details
Other Other 46% -A -267C -124D -267A -266B
view details
Other Other 46% -A -267C -124D -267A -266B
view details
Other Other 46% -A -267C -124D -267A -266B
view details
Other Other 46% -A -267C -124D -267A -266B
view details
Other Other 46% -A -267C -124D -267A -266B
view details
Other Other 46% -A -267C -124D -267A -266B
view details
Other Other 46% -A -267C -124D -267A -266B
view details
Other Other 46% -A -267C -124D -267A -266B
view details
Other Other 46% -A -267C -124D -267A -266B
view details
Other Other 46% -A -267C -124D -267A -266B
view details
Other Other 46% -A -267C -124D -267A -266B
view details
Other Other 46% -A -267C -124D -267A -266B
view details
Other Other 46% -A -267C -124D -267A -266B
view details
Other Other 46% -A -267C -124D -267A -266B
view details
Other Other 46% -A -267C -124D -267A -266B
view details
Other Other 46% -A -267C -124D -267A -266B
view details
Other Other 46% -A -267C -124D -267A -266B
view details
Other Other 46% -A -267C -124D -267A -266B
view details
Other Other 46% -A -267C -124D -267A -266B
view details
Other Other 46% -A -267C -124D -267A -266B
view details
Other Other 46% -A -267C -124D -267A -266B
view details
Other Other 46% -A -267C -124D -267A -266B
view details
Other Other 46% -A -267C -124D -267A -266B
view details
Other Other 46% -A -267C -124D -267A -266B
view details
Other Other 46% -A -267C -124D -267A -266B
Interpreting sequences
Chain A Sequence
WTPFSWVEKYAYAFSGPYNKAEVALTFDDGPDLEFTPKILDKLKQHNVKATFFLLGENAEKFPNIVKRIANEGHVIGNHTYSHPNLAKVNEDEYRNQIIKTEEILNRLAGYAPKFIRPPYGEILENQLKWATEQNFMIVQWSVDTVDWKGVSADTITNNVLGNSFPGSVILQHSTPGGHLQGSVDALDKIIPQLKTKGARFVTLPSMFQTSKER
Chain A Sequence
WTPFSWVEKYAYAFSGPYNKAEVALTFDDGPDLEFTPKILDKLKQHNVKATFFLLGENAEKFPNIVKRIANEGHVIGNHTYSHPNLAKVNEDEYRNQIIKTEEILNRLAGYAPKFIRPYGEILENQLKWATEQNFMIVQWSVDTVDWKGVSADTITNNVLGNSFPGSVILQHSTPGGHLQGSVDALDKIIPQLKTKGARFVTLPSMFQTSKER
Chain A Sequence
WTPFSWVEKYAYAFSGPYNKAEVALTFDDGPDLEFTPKILDKLKQHNVKATFFLLGENAEKFPNIVKRIANEGHVIGNHTYSHPNLAKVNEDEYRNQIIKTEEILNRLAGYAPKFIRPYGEILENQLKWATEQNFMIVQWSVDTVDWKGVSADTITNNVLGNSFPGSVILQHSTPGGHLQGSVDALDKIIPQLKTKGARFVTLPSMFQTSKER
Chain A Sequence
WTPFSWVEKYAYAFSGPYNKAEVALTFDDGPDLEFTPKILDKLKQHNVKATFFLLGENAEKFPNIVKRIANEGHVIGNHTYSHPNLAKVNEDEYRNQIIKTEEILNRLAGYAPKFIRPYGEILENQLKWATEQNFMIVQWSVDTVDWKGVSADTITNNVLGNSFPGSVILQHSTPGGHLQGSVDALDKIIPQLKTKGARFVTLPSMFQTSKER
sequence length 214,214,214,214
structure length 214,213,213,213
publication title Crystal structure of the Bc1960 peptidoglycan N-acetylglucosamine deacetylase in complex with 4-naphthalen-1-yl-~{N}-oxidanyl-benzamide
rcsb
molecule tags Hydrolase
molecule keywords Peptidoglycan N-acetylglucosamine deacetylase
source organism Bacillus cereus (strain atcc 14579 / dsm 31 / jcm 2152 / nbrc 15305 / ncimb 9373
pdb deposition date2017-06-07
LinkProt deposition date2018-06-23
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling