5O4EABEF

Crystal structure of vegf in complex with heterodimeric fcab janusct6
Link type Probability Loop ranges Chain A piercings Chain B piercings Chain E piercings Chain F piercings
view details
Other Other 31% -A -93A -446B -14F
view details
Other Other 31% -A -93A -446B -14F
view details
Other Other 31% -A -93A -446B -14F
view details
Other Other 31% -A -93A -446B -14F
view details
Other Other 31% -A -93A -446B -14F
view details
Other Other 31% -A -93A -446B -14F
view details
Other Other 31% -A -93A -446B -14F
view details
Other Other 31% -A -93A -446B -14F
view details
Other Other 31% -A -93A -446B -14F
view details
Other Other 31% -A -93A -446B -14F
view details
Other Other 31% -A -93A -446B -14F
view details
Other Other 31% -A -93A -446B -14F
view details
Other Other 31% -A -93A -446B -14F
view details
Other Other 31% -A -93A -446B -14F
view details
Other Other 31% -A -93A -446B -14F
view details
Other Other 31% -A -93A -446B -14F
view details
Other Other 31% -A -93A -446B -14F
view details
Other Other 31% -A -93A -446B -14F
view details
Other Other 31% -A -93A -446B -14F
view details
Other Other 31% -A -93A -446B -14F
view details
Other Other 31% -A -93A -446B -14F
view details
Other Other 31% -A -93A -446B -14F
view details
Other Other 31% -A -93A -446B -14F
view details
Other Other 31% -A -93A -446B -14F
view details
Other Other 31% -A -93A -446B -14F
view details
Other Other 31% -A -93A -446B -14F
view details
Other Other 31% -A -93A -446B -14F
view details
Other Other 31% -A -93A -446B -14F
view details
Other Other 31% -A -93A -446B -14F
view details
Other Other 31% -A -93A -446B -14F
view details
Other Other 31% -A -93A -446B -14F
view details
Other Other 31% -A -93A -446B -14F
view details
Other Other 31% -A -93A -446B -14F
view details
Other Other 31% -A -93A -446B -14F
view details
Other Other 31% -A -93A -446B -14F
view details
Other Other 31% -A -93A -446B -14F
view details
Other Other 31% -A -93A -446B -14F
view details
Other Other 31% -A -93A -446B -14F
view details
Other Other 31% -A -93A -446B -14F
Interpreting sequences
Chain A Sequence
GGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYVLPPSRDELTKNQVSLLCLVKGFYPSDIAVEWESNGQPENNYLTWPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
Chain A Sequence
GGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYVYPPSRDELRFYQVSLTCLVKGFYPSDIAVEWESNGQPDIFPNGLNYKTTPPVLDSDGSFALVSKLTVPYPSWLMGTRFSCSVMHEALHNHYTQKHLEYQWP
Chain A Sequence
MVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPK
Chain A Sequence
MVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPK
sequence length 209,216,95,95
structure length 209,216,95,95
publication title Two-Faced Fcab Prevents Polymerization with VEGF and Reveals Thermodynamics and the 2.15 angstrom Crystal Structure of the Complex.
pubmed doi rcsb
molecule tags Immune system
molecule keywords Immunoglobulin gamma-1 heavy chain
source organism Homo sapiens
pdb deposition date2017-05-29
LinkProt deposition date2017-09-02
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling