5O0OACEH

Deglycosylated nogo receptor with native disulfide structure 5
A: 315-318 C: 313-318 E: 313-317 H: 311-321
Link type Probability Loop ranges Chain A piercings Chain C piercings Chain E piercings Chain H piercings
view details
Other Other 43% -A -241C +322C -334C -343E -136H +147H -158H +341H +341E +252H +252A +342C
view details
Other Other 43% -A -241C +322C -334C -343E -136H +147H -158H +341H +341E +252H +252A +342C
view details
Other Other 43% -A -241C +322C -334C -343E -136H +147H -158H +341H +341E +252H +252A +342C
view details
Other Other 43% -A -241C +322C -334C -343E -136H +147H -158H +341H +341E +252H +252A +342C
view details
Other Other 43% -A -241C +322C -334C -343E -136H +147H -158H +341H +341E +252H +252A +342C
view details
Other Other 43% -A -241C +322C -334C -343E -136H +147H -158H +341H +341E +252H +252A +342C
view details
Other Other 43% -A -241C +322C -334C -343E -136H +147H -158H +341H +341E +252H +252A +342C
view details
Other Other 43% -A -241C +322C -334C -343E -136H +147H -158H +341H +341E +252H +252A +342C
view details
Other Other 43% -A -241C +322C -334C -343E -136H +147H -158H +341H +341E +252H +252A +342C
view details
Other Other 43% -A -241C +322C -334C -343E -136H +147H -158H +341H +341E +252H +252A +342C
view details
Other Other 43% -A -241C +322C -334C -343E -136H +147H -158H +341H +341E +252H +252A +342C
view details
Other Other 43% -A -241C +322C -334C -343E -136H +147H -158H +341H +341E +252H +252A +342C
view details
Other Other 43% -A -241C +322C -334C -343E -136H +147H -158H +341H +341E +252H +252A +342C
view details
Other Other 43% -A -241C +322C -334C -343E -136H +147H -158H +341H +341E +252H +252A +342C
view details
Other Other 43% -A -241C +322C -334C -343E -136H +147H -158H +341H +341E +252H +252A +342C
view details
Other Other 43% -A -241C +322C -334C -343E -136H +147H -158H +341H +341E +252H +252A +342C
view details
Other Other 43% -A -241C +322C -334C -343E -136H +147H -158H +341H +341E +252H +252A +342C
view details
Other Other 43% -A -241C +322C -334C -343E -136H +147H -158H +341H +341E +252H +252A +342C
view details
Other Other 43% -A -241C +322C -334C -343E -136H +147H -158H +341H +341E +252H +252A +342C
view details
Other Other 43% -A -241C +322C -334C -343E -136H +147H -158H +341H +341E +252H +252A +342C
view details
Other Other 43% -A -241C +322C -334C -343E -136H +147H -158H +341H +341E +252H +252A +342C
view details
Other Other 43% -A -241C +322C -334C -343E -136H +147H -158H +341H +341E +252H +252A +342C
view details
Other Other 43% -A -241C +322C -334C -343E -136H +147H -158H +341H +341E +252H +252A +342C
view details
Other Other 43% -A -241C +322C -334C -343E -136H +147H -158H +341H +341E +252H +252A +342C
view details
Other Other 43% -A -241C +322C -334C -343E -136H +147H -158H +341H +341E +252H +252A +342C
view details
Other Other 43% -A -241C +322C -334C -343E -136H +147H -158H +341H +341E +252H +252A +342C
view details
Other Other 43% -A -241C +322C -334C -343E -136H +147H -158H +341H +341E +252H +252A +342C
view details
Other Other 43% -A -241C +322C -334C -343E -136H +147H -158H +341H +341E +252H +252A +342C
view details
Other Other 43% -A -241C +322C -334C -343E -136H +147H -158H +341H +341E +252H +252A +342C
view details
Other Other 43% -A -241C +322C -334C -343E -136H +147H -158H +341H +341E +252H +252A +342C
view details
Other Other 43% -A -241C +322C -334C -343E -136H +147H -158H +341H +341E +252H +252A +342C
view details
Other Other 43% -A -241C +322C -334C -343E -136H +147H -158H +341H +341E +252H +252A +342C
Interpreting sequences
Chain A Sequence
SPCPGACVCYNEPKVTTSCPQQGLQAVPTGIPASSQRIFLHGNRISHVPAASFQSCRNLTILWLHSNALARIDAAAFTGLTLLEQLDLSDNAQLHVVDPTTFHGLGHLHTLHLDRCGLRELGPGLFRGLAALQYLYLQDNNLQALPDNTFRDLGNLTHLFLHGNRIPSVPEHAFRGLHSLDRLLLHQNHVARVHPHAFRDLGRLMTLYLFANNLSMLPAEVLMPLRSLQYLRLNDNPWVCDCRARPLWAWLQKFRGSSSEVPCNLPQRLADRDLKRLAASDLEGCAVASGP--PIQTSQLTDEELLSLPKCCQAAAHH
Chain A Sequence
PCPGACVCYNEPKVTTSCPQQGLQAVPTGIPASSQRIFLHGNRISHVPAASFQSCRNLTILWLHSNALARIDAAAFTGLTLLEQLDLSDNAQLHVVDPTTFHGLGHLHTLHLDRCGLRELGPGLFRGLAALQYLYLQDNNLQALPDNTFRDLGNLTHLFLHGNRIPSVPEHAFRGLHSLDRLLLHQNHVARVHPHAFRDLGRLMTLYLFANNLSMLPAEVLMPLRSLQYLRLNDNPWVCDCRARPLWAWLQKFRGSSSEVPCNLPQRLADRDLKRLAASDLEGCAVAS----PIQTSQLTDEELLSLPKCCQAAAHH
Chain A Sequence
GSPCPGACVCYNEPKVTTSCPQQGLQAVPTGIPASSQRIFLHGNRISHVPAASFQSCRNLTILWLHSNALARIDAAAFTGLTLLEQLDLSDNAQLHVVDPTTFHGLGHLHTLHLDRCGLRELGPGLFRGLAALQYLYLQDNNLQALPDNTFRDLGNLTHLFLHGNRIPSVPEHAFRGLHSLDRLLLHQNHVARVHPHAFRDLGRLMTLYLFANNLSMLPAEVLMPLRSLQYLRLNDNPWVCDCRARPLWAWLQKFRGSSSEVPCNLPQRLADRDLKRLAASDLEGCAVAS---RPIQTSQLTDEELLSLPKCCQAAAH
Chain A Sequence
SPCPGACVCYNEPKVTTSCPQQGLQAVPTGIPASSQRIFLHGNRISHVPAASFQSCRNLTILWLHSNALARIDAAAFTGLTLLEQLDLSDNAQLHVVDPTTFHGLGHLHTLHLDRCGLRELGPGLFRGLAALQYLYLQDNNLQALPDNTFRDLGNLTHLFLHGNRIPSVPEHAFRGLHSLDRLLLHQNHVARVHPHAFRDLGRLMTLYLFANNLSMLPAEVLMPLRSLQYLRLNDNPWVCDCRARPLWAWLQKFRGSSSEVPCNLPQRLADRDLKRLAASDLEGCAV---------TSQLTDEELLSLPKCCQAAAH
sequence length 318,317,318,317
structure length 316,313,315,308
publication title Nogo receptor crystal structures with a native disulfide pattern suggest a novel mode of self-interaction
doi rcsb
molecule tags Signaling protein
molecule keywords Reticulon-4 receptor
source organism Mus musculus
missing residues A: 315-318 C: 313-318 E: 313-317 H: 311-321
pdb deposition date2017-05-16
LinkProt deposition date2017-10-21
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling