| Link type | Probability | Loop ranges | Chain A piercings | Chain B piercings | Chain C piercings | Chain D piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Other | 34% | -A | +54A -245A | |||||||||||
| view details |
|
Other | 34% | -A | +54A -245A | |||||||||||
| view details |
|
Other | 34% | -A | +54A -245A | |||||||||||
| view details |
|
Other | 34% | -A | +54A -245A | |||||||||||
| view details |
|
Other | 34% | -A | +54A -245A | |||||||||||
| view details |
|
Other | 34% | -A | +54A -245A | |||||||||||
| view details |
|
Other | 34% | -A | +54A -245A | |||||||||||
| view details |
|
Other | 34% | -A | +54A -245A | |||||||||||
| view details |
|
Other | 34% | -A | +54A -245A | |||||||||||
| view details |
|
Other | 34% | -A | +54A -245A | |||||||||||
| view details |
|
Other | 34% | -A | +54A -245A | |||||||||||
| view details |
|
Other | 34% | -A | +54A -245A | |||||||||||
| view details |
|
Other | 34% | -A | +54A -245A | |||||||||||
| view details |
|
Other | 34% | -A | +54A -245A | |||||||||||
| view details |
|
Other | 34% | -A | +54A -245A | |||||||||||
| view details |
|
Other | 34% | -A | +54A -245A | |||||||||||
| view details |
|
Other | 34% | -A | +54A -245A | |||||||||||
| view details |
|
Other | 34% | -A | +54A -245A | |||||||||||
| view details |
|
Other | 34% | -A | +54A -245A | |||||||||||
| view details |
|
Other | 34% | -A | +54A -245A | |||||||||||
| view details |
|
Other | 34% | -A | +54A -245A | |||||||||||
| view details |
|
Other | 34% | -A | +54A -245A | |||||||||||
| view details |
|
Other | 34% | -A | +54A -245A | |||||||||||
| view details |
|
Other | 34% | -A | +54A -245A | |||||||||||
| view details |
|
Other | 34% | -A | +54A -245A | |||||||||||
| view details |
|
Other | 34% | -A | +54A -245A | |||||||||||
| view details |
|
Other | 34% | -A | +54A -245A | |||||||||||
| view details |
|
Other | 34% | -A | +54A -245A | |||||||||||
| view details |
|
Other | 34% | -A | +54A -245A | |||||||||||
| view details |
|
Other | 34% | -A | +54A -245A | |||||||||||
| view details |
|
Other | 34% | -A | +54A -245A | |||||||||||
| view details |
|
Other | 34% | -A | +54A -245A | |||||||||||
| view details |
|
Other | 34% | -A | +54A -245A | |||||||||||
| view details |
|
Other | 34% | -A | +54A -245A | |||||||||||
| view details |
|
Other | 34% | -A | +54A -245A | |||||||||||
| view details |
|
Other | 34% | -A | +54A -245A | |||||||||||
| view details |
|
Other | 34% | -A | +54A -245A | |||||||||||
| view details |
|
Other | 34% | -A | +54A -245A | |||||||||||
| view details |
|
Other | 34% | -A | +54A -245A | |||||||||||
| view details |
|
Other | 34% | -A | +54A -245A | |||||||||||
| view details |
|
Other | 34% | -A | +54A -245A | |||||||||||
| view details |
|
Other | 34% | -A | +54A -245A | |||||||||||
| view details |
|
Other | 34% | -A | +54A -245A | |||||||||||
| view details |
|
Other | 34% | -A | +54A -245A | |||||||||||
| view details |
|
Other | 34% | -A | +54A -245A | |||||||||||
Chain A Sequence |
LVHGGPCDKTSHPYQAALYTS-GHLLCGGVLIHPLWVLTAAHCKKPNLQVFL-GKHNLGQQESSQEQSSVVRAVIHPDYDAASHDQDIMLLRLARPAKLSELIQPLPLER-DCSA-QTTSCHILGWGKTADG--DFPDTIQCAYIHLVSREECEHAYPGQITQNMLCAGDEKYGKDSCQGDSGGPLVC----GDHLRGLVSWGNI-PCGSKEKPGVYTNVCRYTNWIQKTIQA |
Chain A Sequence |
EVCSEQAETGPCR |
Chain A Sequence |
EVCSEQAETGPCRAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCG |
Chain A Sequence |
AMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCGS |
| sequence length | 222,13,54,42 |
| structure length | 222,13,54,42 |
| publication title |
Combinatorial Engineering of Proteolytically Resistant APPI Variants that Selectively Inhibit Human Kallikrein 6 for Cancer Therapy
rcsb |
| molecule tags | Hydrolase |
| molecule keywords | Kallikrein-6 |
| source organism | Homo sapiens |
| missing residues | A: 36-38,67-69,125-127,130-132,147-150,203-208,220-222 |
| pdb deposition date | 2017-05-09 |
| LinkProt deposition date | 2018-06-03 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
