5NWEABD

Complex of h275y mutant variant of neuraminidase from h1n1 influenza virus with oseltamivir
Link type Probability Loop ranges Chain A piercings Chain B piercings Chain D piercings
view details
Other Other 30% -A +85B -107B -123B -469D -470A -470A -100D -397D +443D -457D +92A -102A +444A +469B
view details
Other Other 30% -A +85B -107B -123B -469D -470A -470A -100D -397D +443D -457D +92A -102A +444A +469B
view details
Other Other 30% -A +85B -107B -123B -469D -470A -470A -100D -397D +443D -457D +92A -102A +444A +469B
view details
Other Other 30% -A +85B -107B -123B -469D -470A -470A -100D -397D +443D -457D +92A -102A +444A +469B
view details
Other Other 30% -A +85B -107B -123B -469D -470A -470A -100D -397D +443D -457D +92A -102A +444A +469B
view details
Other Other 30% -A +85B -107B -123B -469D -470A -470A -100D -397D +443D -457D +92A -102A +444A +469B
view details
Other Other 30% -A +85B -107B -123B -469D -470A -470A -100D -397D +443D -457D +92A -102A +444A +469B
view details
Other Other 30% -A +85B -107B -123B -469D -470A -470A -100D -397D +443D -457D +92A -102A +444A +469B
view details
Other Other 30% -A +85B -107B -123B -469D -470A -470A -100D -397D +443D -457D +92A -102A +444A +469B
view details
Other Other 30% -A +85B -107B -123B -469D -470A -470A -100D -397D +443D -457D +92A -102A +444A +469B
view details
Other Other 30% -A +85B -107B -123B -469D -470A -470A -100D -397D +443D -457D +92A -102A +444A +469B
view details
Other Other 30% -A +85B -107B -123B -469D -470A -470A -100D -397D +443D -457D +92A -102A +444A +469B
view details
Other Other 30% -A +85B -107B -123B -469D -470A -470A -100D -397D +443D -457D +92A -102A +444A +469B
view details
Other Other 30% -A +85B -107B -123B -469D -470A -470A -100D -397D +443D -457D +92A -102A +444A +469B
view details
Other Other 30% -A +85B -107B -123B -469D -470A -470A -100D -397D +443D -457D +92A -102A +444A +469B
view details
Other Other 30% -A +85B -107B -123B -469D -470A -470A -100D -397D +443D -457D +92A -102A +444A +469B
view details
Other Other 30% -A +85B -107B -123B -469D -470A -470A -100D -397D +443D -457D +92A -102A +444A +469B
view details
Other Other 30% -A +85B -107B -123B -469D -470A -470A -100D -397D +443D -457D +92A -102A +444A +469B
view details
Other Other 30% -A +85B -107B -123B -469D -470A -470A -100D -397D +443D -457D +92A -102A +444A +469B
view details
Other Other 30% -A +85B -107B -123B -469D -470A -470A -100D -397D +443D -457D +92A -102A +444A +469B
view details
Other Other 30% -A +85B -107B -123B -469D -470A -470A -100D -397D +443D -457D +92A -102A +444A +469B
view details
Other Other 30% -A +85B -107B -123B -469D -470A -470A -100D -397D +443D -457D +92A -102A +444A +469B
view details
Other Other 30% -A +85B -107B -123B -469D -470A -470A -100D -397D +443D -457D +92A -102A +444A +469B
view details
Other Other 30% -A +85B -107B -123B -469D -470A -470A -100D -397D +443D -457D +92A -102A +444A +469B
view details
Other Other 30% -A +85B -107B -123B -469D -470A -470A -100D -397D +443D -457D +92A -102A +444A +469B
view details
Other Other 30% -A +85B -107B -123B -469D -470A -470A -100D -397D +443D -457D +92A -102A +444A +469B
view details
Other Other 30% -A +85B -107B -123B -469D -470A -470A -100D -397D +443D -457D +92A -102A +444A +469B
view details
Other Other 30% -A +85B -107B -123B -469D -470A -470A -100D -397D +443D -457D +92A -102A +444A +469B
view details
Other Other 30% -A +85B -107B -123B -469D -470A -470A -100D -397D +443D -457D +92A -102A +444A +469B
view details
Other Other 30% -A +85B -107B -123B -469D -470A -470A -100D -397D +443D -457D +92A -102A +444A +469B
view details
Other Other 30% -A +85B -107B -123B -469D -470A -470A -100D -397D +443D -457D +92A -102A +444A +469B
view details
Other Other 30% -A +85B -107B -123B -469D -470A -470A -100D -397D +443D -457D +92A -102A +444A +469B
view details
Other Other 30% -A +85B -107B -123B -469D -470A -470A -100D -397D +443D -457D +92A -102A +444A +469B
view details
Other Other 30% -A +85B -107B -123B -469D -470A -470A -100D -397D +443D -457D +92A -102A +444A +469B
view details
Other Other 30% -A +85B -107B -123B -469D -470A -470A -100D -397D +443D -457D +92A -102A +444A +469B
view details
Other Other 30% -A +85B -107B -123B -469D -470A -470A -100D -397D +443D -457D +92A -102A +444A +469B
view details
Other Other 30% -A +85B -107B -123B -469D -470A -470A -100D -397D +443D -457D +92A -102A +444A +469B
view details
Other Other 30% -A +85B -107B -123B -469D -470A -470A -100D -397D +443D -457D +92A -102A +444A +469B
view details
Other Other 30% -A +85B -107B -123B -469D -470A -470A -100D -397D +443D -457D +92A -102A +444A +469B
view details
Other Other 30% -A +85B -107B -123B -469D -470A -470A -100D -397D +443D -457D +92A -102A +444A +469B
view details
Other Other 30% -A +85B -107B -123B -469D -470A -470A -100D -397D +443D -457D +92A -102A +444A +469B
view details
Other Other 30% -A +85B -107B -123B -469D -470A -470A -100D -397D +443D -457D +92A -102A +444A +469B
view details
Other Other 30% -A +85B -107B -123B -469D -470A -470A -100D -397D +443D -457D +92A -102A +444A +469B
Interpreting sequences
Chain A Sequence
SVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYYYEECSCYPDSSEITCVCRDNWHGSNRPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Chain A Sequence
SVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYYYEECSCYPDSSEITCVCRDNWHGSNRPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Chain A Sequence
SVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYYYEECSCYPDSSEITCVCRDNWHGSNRPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
sequence length 388,388,388
structure length 388,388,388
publication title Kinetic, Thermodynamic, and Structural Analysis of Drug Resistance Mutations in Neuraminidase from the 2009 Pandemic Influenza Virus.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Neuraminidase
source organism Influenza a virus
pdb deposition date2017-05-05
LinkProt deposition date2018-07-06
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling