| Link type | Probability | Loop ranges | Chain A piercings | Chain B piercings | Chain C piercings | Chain D piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Other | 76% | -A | -101B +280B -424B +442B -463B -469C | |||||||||||
| view details |
|
Other | 76% | -A | -101B +280B -424B +442B -463B -469C | |||||||||||
| view details |
|
Other | 76% | -A | -101B +280B -424B +442B -463B -469C | |||||||||||
| view details |
|
Other | 76% | -A | -101B +280B -424B +442B -463B -469C | |||||||||||
| view details |
|
Other | 76% | -A | -101B +280B -424B +442B -463B -469C | |||||||||||
| view details |
|
Other | 76% | -A | -101B +280B -424B +442B -463B -469C | |||||||||||
| view details |
|
Other | 76% | -A | -101B +280B -424B +442B -463B -469C | |||||||||||
| view details |
|
Other | 76% | -A | -101B +280B -424B +442B -463B -469C | |||||||||||
| view details |
|
Other | 76% | -A | -101B +280B -424B +442B -463B -469C | |||||||||||
| view details |
|
Other | 76% | -A | -101B +280B -424B +442B -463B -469C | |||||||||||
| view details |
|
Other | 76% | -A | -101B +280B -424B +442B -463B -469C | |||||||||||
| view details |
|
Other | 76% | -A | -101B +280B -424B +442B -463B -469C | |||||||||||
| view details |
|
Other | 76% | -A | -101B +280B -424B +442B -463B -469C | |||||||||||
| view details |
|
Other | 76% | -A | -101B +280B -424B +442B -463B -469C | |||||||||||
| view details |
|
Other | 76% | -A | -101B +280B -424B +442B -463B -469C | |||||||||||
| view details |
|
Other | 76% | -A | -101B +280B -424B +442B -463B -469C | |||||||||||
| view details |
|
Other | 76% | -A | -101B +280B -424B +442B -463B -469C | |||||||||||
| view details |
|
Other | 76% | -A | -101B +280B -424B +442B -463B -469C | |||||||||||
| view details |
|
Other | 76% | -A | -101B +280B -424B +442B -463B -469C | |||||||||||
| view details |
|
Other | 76% | -A | -101B +280B -424B +442B -463B -469C | |||||||||||
| view details |
|
Other | 76% | -A | -101B +280B -424B +442B -463B -469C | |||||||||||
| view details |
|
Other | 76% | -A | -101B +280B -424B +442B -463B -469C | |||||||||||
| view details |
|
Other | 76% | -A | -101B +280B -424B +442B -463B -469C | |||||||||||
| view details |
|
Other | 76% | -A | -101B +280B -424B +442B -463B -469C | |||||||||||
| view details |
|
Other | 76% | -A | -101B +280B -424B +442B -463B -469C | |||||||||||
| view details |
|
Other | 76% | -A | -101B +280B -424B +442B -463B -469C | |||||||||||
| view details |
|
Other | 76% | -A | -101B +280B -424B +442B -463B -469C | |||||||||||
| view details |
|
Other | 76% | -A | -101B +280B -424B +442B -463B -469C | |||||||||||
| view details |
|
Other | 76% | -A | -101B +280B -424B +442B -463B -469C | |||||||||||
| view details |
|
Other | 76% | -A | -101B +280B -424B +442B -463B -469C | |||||||||||
| view details |
|
Other | 76% | -A | -101B +280B -424B +442B -463B -469C | |||||||||||
| view details |
|
Other | 76% | -A | -101B +280B -424B +442B -463B -469C | |||||||||||
| view details |
|
Other | 76% | -A | -101B +280B -424B +442B -463B -469C | |||||||||||
| view details |
|
Other | 76% | -A | -101B +280B -424B +442B -463B -469C | |||||||||||
| view details |
|
Other | 76% | -A | -101B +280B -424B +442B -463B -469C | |||||||||||
| view details |
|
Other | 76% | -A | -101B +280B -424B +442B -463B -469C | |||||||||||
| view details |
|
Other | 76% | -A | -101B +280B -424B +442B -463B -469C | |||||||||||
Chain A Sequence |
SVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYYYEECSCYPDSSEITCVCRDNWHGSNRPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK |
Chain A Sequence |
SVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYYYEECSCYPDSSEITCVCRDNWHGSNRPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK |
Chain A Sequence |
SVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYYYEECSCYPDSSEITCVCRDNWHGSNRPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK |
Chain A Sequence |
SVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYYYEECSCYPDSSEITCVCRDNWHGSNRPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK |
| sequence length | 388,388,388,388 |
| structure length | 388,388,388,388 |
| publication title |
Kinetic, Thermodynamic, and Structural Analysis of Drug Resistance Mutations in Neuraminidase from the 2009 Pandemic Influenza Virus.
pubmed doi rcsb |
| molecule tags | Hydrolase |
| molecule keywords | Neuraminidase |
| source organism | Influenza a virus |
| pdb deposition date | 2017-05-05 |
| LinkProt deposition date | 2018-07-06 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
