5NL1ABDF

Shigella ipaa-vbs3/tbs in complex with the talin vbs1 domain 488-512
Link type Probability Loop ranges Chain A piercings Chain B piercings Chain D piercings Chain F piercings
view details
Other Other 31% -A -629B -578D +488A -629A
view details
Other Other 31% -A -629B -578D +488A -629A
view details
Other Other 31% -A -629B -578D +488A -629A
view details
Other Other 31% -A -629B -578D +488A -629A
view details
Other Other 31% -A -629B -578D +488A -629A
view details
Other Other 31% -A -629B -578D +488A -629A
view details
Other Other 31% -A -629B -578D +488A -629A
view details
Other Other 31% -A -629B -578D +488A -629A
view details
Other Other 31% -A -629B -578D +488A -629A
view details
Other Other 31% -A -629B -578D +488A -629A
view details
Other Other 31% -A -629B -578D +488A -629A
view details
Other Other 31% -A -629B -578D +488A -629A
view details
Other Other 31% -A -629B -578D +488A -629A
view details
Other Other 31% -A -629B -578D +488A -629A
view details
Other Other 31% -A -629B -578D +488A -629A
view details
Other Other 31% -A -629B -578D +488A -629A
view details
Other Other 31% -A -629B -578D +488A -629A
view details
Other Other 31% -A -629B -578D +488A -629A
view details
Other Other 31% -A -629B -578D +488A -629A
view details
Other Other 31% -A -629B -578D +488A -629A
view details
Other Other 31% -A -629B -578D +488A -629A
view details
Other Other 31% -A -629B -578D +488A -629A
view details
Other Other 31% -A -629B -578D +488A -629A
view details
Other Other 31% -A -629B -578D +488A -629A
view details
Other Other 31% -A -629B -578D +488A -629A
view details
Other Other 31% -A -629B -578D +488A -629A
view details
Other Other 31% -A -629B -578D +488A -629A
view details
Other Other 31% -A -629B -578D +488A -629A
view details
Other Other 31% -A -629B -578D +488A -629A
view details
Other Other 31% -A -629B -578D +488A -629A
view details
Other Other 31% -A -629B -578D +488A -629A
view details
Other Other 31% -A -629B -578D +488A -629A
Interpreting sequences
Chain A Sequence
LTSAQQALTGTINSSMQAVQAAQATLDDFETLPPLGQDAASKAWRKNKMDESKHEIHSQVDAITAGTASVVNLTAGDPAETDYTAVGCAVTTISSNLTEMSRGVKLLAALLEDEGGNGRPLLQAAKGLAGAVSELLRSAQP
Chain A Sequence
PLTSAQQALTGTINSSMQAVQAAQATLDDFETLPPLGQDAASKAWRKNKMDESKHEIHSQVDAITAGTASVVNLTAGDPAETDYTAVGCAVTTISSNLTEMSRGVKLLAALLEDEGGNGRPLLQAAKGLAGAVSELLRSAQP
Chain A Sequence
LTSAQQALTGTINSSMQAVQAAQATLDDFETLPPLGQDAASKAWRKNKMDESKHEIHSQVDAITAGTASVVNLTAGDPAETDYTAVGCAVTTISSNLTEMSRGVKLLAALLEDEGGNGRPLLQAAKGLAGAVSELLRSAQP
Chain A Sequence
PLTSAQQALTGTINSSMQAVQAAQATLDDFETLPPLGQDAASKAWRKNKMDESKHEIHSQVDAITAGTASVVNLTAGDPAETDYTAVGCAVTTISSNLTEMSRGVKLLAALLEDEGGNGRPLLQAAKGLAGAVSELLRSAQP
sequence length 141,142,141,142
structure length 141,142,141,142
publication title A novel activation state of talin revealed by a Shigella Ipa vinculin-binding site
rcsb
molecule tags Structural protein
molecule keywords Talin-1
source organism Mus musculus
pdb deposition date2017-04-03
LinkProt deposition date2018-05-19
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling