5NBMCDGH

Crystal structure of the arp4-n-actin(atp-state) heterodimer bound by a nanobody
C: 40-50 D: 40-50
Link type Probability Loop ranges Chain C piercings Chain D piercings Chain G piercings Chain H piercings
view details
Other Other 40% -C +6C +375D -17H
view details
Other Other 40% -C +6C +375D -17H
view details
Other Other 40% -C +6C +375D -17H
view details
Other Other 40% -C +6C +375D -17H
view details
Other Other 40% -C +6C +375D -17H
view details
Other Other 40% -C +6C +375D -17H
view details
Other Other 40% -C +6C +375D -17H
view details
Other Other 40% -C +6C +375D -17H
view details
Other Other 40% -C +6C +375D -17H
view details
Other Other 40% -C +6C +375D -17H
view details
Other Other 40% -C +6C +375D -17H
view details
Other Other 40% -C +6C +375D -17H
view details
Other Other 40% -C +6C +375D -17H
view details
Other Other 40% -C +6C +375D -17H
view details
Other Other 40% -C +6C +375D -17H
view details
Other Other 40% -C +6C +375D -17H
view details
Other Other 40% -C +6C +375D -17H
view details
Other Other 40% -C +6C +375D -17H
view details
Other Other 40% -C +6C +375D -17H
view details
Other Other 40% -C +6C +375D -17H
view details
Other Other 40% -C +6C +375D -17H
view details
Other Other 40% -C +6C +375D -17H
view details
Other Other 40% -C +6C +375D -17H
view details
Other Other 40% -C +6C +375D -17H
view details
Other Other 40% -C +6C +375D -17H
view details
Other Other 40% -C +6C +375D -17H
view details
Other Other 40% -C +6C +375D -17H
view details
Other Other 40% -C +6C +375D -17H
view details
Other Other 40% -C +6C +375D -17H
view details
Other Other 40% -C +6C +375D -17H
view details
Other Other 40% -C +6C +375D -17H
view details
Other Other 40% -C +6C +375D -17H
view details
Other Other 40% -C +6C +375D -17H
view details
Other Other 40% -C +6C +375D -17H
view details
Other Other 40% -C +6C +375D -17H
view details
Other Other 40% -C +6C +375D -17H
view details
Other Other 40% -C +6C +375D -17H
view details
Other Other 40% -C +6C +375D -17H
view details
Other Other 40% -C +6C +375D -17H
view details
Other Other 40% -C +6C +375D -17H
view details
Other Other 40% -C +6C +375D -17H
Interpreting sequences
Chain C Sequence
DSEVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRH---------KDSYVGDEAQSKRGILTLRYPIEGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKC
Chain C Sequence
DSEVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRH---------KDSYVGDEAQSKRGILTLRYPIEGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKC
Chain C Sequence
XXXXXXXXXXXXXXXXX
Chain C Sequence
XXXXXXXXXXXXXXXX
sequence length 373,373,17,16
structure length 363,363,17,16
publication title Structure 1
rcsb
molecule tags Hydrolase
molecule keywords Actin-related protein 4
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
missing residues C: 40-50 D: 40-50
pdb deposition date2017-03-02
LinkProt deposition date2018-08-26
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling