5N92AF

Crystal structure of human il-17af
A: 57-64
Link type Probability Loop ranges Chain A piercings Chain F piercings
view details
Hopf.2 Hopf.2 55% -A -164F -65A
view details
Hopf.2 Hopf.2 55% -A -164F -65A
view details
Hopf.2 Hopf.2 55% -A -164F -65A
view details
Hopf.2 Hopf.2 55% -A -164F -65A
view details
Hopf.2 Hopf.2 55% -A -164F -65A
view details
Hopf.2 Hopf.2 55% -A -164F -65A
view details
Hopf.2 Hopf.2 55% -A -164F -65A
view details
Hopf.2 Hopf.2 55% -A -164F -65A
view details
Hopf.2 Hopf.2 55% -A -164F -65A
view details
Hopf.2 Hopf.2 55% -A -164F -65A
view details
Hopf.2 Hopf.2 55% -A -164F -65A
Interpreting sequences
Chain A Sequence
KNFPRTVMVNLNIHNRNTN------SDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHH
Chain A Sequence
PESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHHVQ
sequence length 115,120
structure length 109,120
publication title The human IL-17A/F heterodimer: a two-faced cytokine with unique receptor recognition properties
doi rcsb
molecule tags Immune system
molecule keywords Interleukin-17A
source organism Homo sapiens
missing residues A: 57-64
pdb deposition date2017-02-24
LinkProt deposition date2017-09-10
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling