5MLUACEM

Crystal structure of the pfv gag cbs bound to a mononucleosome
Link type Probability Chain A piercings Chain C piercings Chain E piercings Chain M piercings
view details
Other Other 52% -107C -136E -551E -136M -135A -111C -551M
view details
Other Other 52% -107C -136E -551E -136M -135A -111C -551M
view details
Other Other 52% -107C -136E -551E -136M -135A -111C -551M
view details
Other Other 52% -107C -136E -551E -136M -135A -111C -551M
view details
Other Other 52% -107C -136E -551E -136M -135A -111C -551M
view details
Other Other 52% -107C -136E -551E -136M -135A -111C -551M
view details
Other Other 52% -107C -136E -551E -136M -135A -111C -551M
view details
Other Other 52% -107C -136E -551E -136M -135A -111C -551M
view details
Other Other 52% -107C -136E -551E -136M -135A -111C -551M
view details
Other Other 52% -107C -136E -551E -136M -135A -111C -551M
view details
Other Other 52% -107C -136E -551E -136M -135A -111C -551M
view details
Other Other 52% -107C -136E -551E -136M -135A -111C -551M
view details
Other Other 52% -107C -136E -551E -136M -135A -111C -551M
view details
Other Other 52% -107C -136E -551E -136M -135A -111C -551M
view details
Other Other 52% -107C -136E -551E -136M -135A -111C -551M
view details
Other Other 52% -107C -136E -551E -136M -135A -111C -551M
view details
Other Other 52% -107C -136E -551E -136M -135A -111C -551M
view details
Other Other 52% -107C -136E -551E -136M -135A -111C -551M
view details
Other Other 52% -107C -136E -551E -136M -135A -111C -551M
view details
Other Other 52% -107C -136E -551E -136M -135A -111C -551M
view details
Other Other 52% -107C -136E -551E -136M -135A -111C -551M
view details
Other Other 52% -107C -136E -551E -136M -135A -111C -551M
Interpreting sequences
Chain A Sequence
HRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Chain A Sequence
TRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPK
Chain A Sequence
HRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Chain A Sequence
GGYNLRPRTYQPQRYG
sequence length 97,103,97,16
structure length 97,103,97,16
publication title Structural basis for spumavirus GAG tethering to chromatin
doi rcsb
molecule tags Dna binding protein
molecule keywords Histone H3.2
source organism Xenopus laevis
pdb deposition date2016-12-07
LinkProt deposition date2017-05-14
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling