5MGSABGH

Human receptor nkr-p1 in deglycosylated form, extracellular domain
Link type Probability Loop ranges Chain A piercings Chain B piercings Chain G piercings Chain H piercings
view details
Other Other 38% -A -218B -112G -218G -219G -142H -206H -211H -219H
view details
Other Other 38% -A -218B -112G -218G -219G -142H -206H -211H -219H
view details
Other Other 38% -A -218B -112G -218G -219G -142H -206H -211H -219H
view details
Other Other 38% -A -218B -112G -218G -219G -142H -206H -211H -219H
view details
Other Other 38% -A -218B -112G -218G -219G -142H -206H -211H -219H
view details
Other Other 38% -A -218B -112G -218G -219G -142H -206H -211H -219H
view details
Other Other 38% -A -218B -112G -218G -219G -142H -206H -211H -219H
view details
Other Other 38% -A -218B -112G -218G -219G -142H -206H -211H -219H
view details
Other Other 38% -A -218B -112G -218G -219G -142H -206H -211H -219H
view details
Other Other 38% -A -218B -112G -218G -219G -142H -206H -211H -219H
view details
Other Other 38% -A -218B -112G -218G -219G -142H -206H -211H -219H
view details
Other Other 38% -A -218B -112G -218G -219G -142H -206H -211H -219H
view details
Other Other 38% -A -218B -112G -218G -219G -142H -206H -211H -219H
view details
Other Other 38% -A -218B -112G -218G -219G -142H -206H -211H -219H
view details
Other Other 38% -A -218B -112G -218G -219G -142H -206H -211H -219H
view details
Other Other 38% -A -218B -112G -218G -219G -142H -206H -211H -219H
view details
Other Other 38% -A -218B -112G -218G -219G -142H -206H -211H -219H
view details
Other Other 38% -A -218B -112G -218G -219G -142H -206H -211H -219H
view details
Other Other 38% -A -218B -112G -218G -219G -142H -206H -211H -219H
view details
Other Other 38% -A -218B -112G -218G -219G -142H -206H -211H -219H
view details
Other Other 38% -A -218B -112G -218G -219G -142H -206H -211H -219H
view details
Other Other 38% -A -218B -112G -218G -219G -142H -206H -211H -219H
view details
Other Other 38% -A -218B -112G -218G -219G -142H -206H -211H -219H
view details
Other Other 38% -A -218B -112G -218G -219G -142H -206H -211H -219H
view details
Other Other 38% -A -218B -112G -218G -219G -142H -206H -211H -219H
view details
Other Other 38% -A -218B -112G -218G -219G -142H -206H -211H -219H
view details
Other Other 38% -A -218B -112G -218G -219G -142H -206H -211H -219H
view details
Other Other 38% -A -218B -112G -218G -219G -142H -206H -211H -219H
view details
Other Other 38% -A -218B -112G -218G -219G -142H -206H -211H -219H
view details
Other Other 38% -A -218B -112G -218G -219G -142H -206H -211H -219H
view details
Other Other 38% -A -218B -112G -218G -219G -142H -206H -211H -219H
Interpreting sequences
Chain A Sequence
LLNCPIYWQQLREKCLLFSHTVNPWNNSLADCSTKESSLLLIRDKDELIHTQNLIRDKAILFWIGLNFSLSEKNWKWINGSFLNSNDLEIRGDAKENSCISISQTSVYSEYCSTEIRWICQKEL
Chain A Sequence
GLLNCPIYWQQLREKCLLFSHTVNPWNNSLADCSTKESSLLLIRDKDELIHTQNLIRDKAILFWIGLNFSLSEKNWKWINGSFLNSNDLEIRGDAKENSCISISQTSVYSEYCSTEIRWICQKELTPV
Chain A Sequence
LLNCPIYWQQLREKCLLFSHTVNPWNNSLADCSTKESSLLLIRDKDELIHTQNLIRDKAILFWIGLNFSLSEKNWKWINGSFLNSNDLEIRGDAKENSCISISQTSVYSEYCSTEIRWICQKEL
Chain A Sequence
GLLNCPIYWQQLREKCLLFSHTVNPWNNSLADCSTKESSLLLIRDKDELIHTQNLIRDKAILFWIGLNFSLSEKNWKWINGSFLNSNDLEIRGDAKENSCISISQTSVYSEYCSTEIRWICQKELTPVR
sequence length 124,128,124,129
structure length 124,128,124,129
publication title Structure of human NKR-P1:LLT1 receptor complex
rcsb
molecule tags Immune system
molecule keywords Killer cell lectin-like receptor subfamily B member 1
source organism Homo sapiens
pdb deposition date2016-11-22
LinkProt deposition date2018-05-25
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling