5LQLABCD

High resolution crystal structure of the 4-hydroxybenzoyl coenzyme-a thioesterase from staphylococcus aureus
Link type Probability Loop ranges Chain A piercings Chain B piercings Chain C piercings Chain D piercings
view details
Other Other 30% -A +94D -156D
view details
Other Other 30% -A +94D -156D
view details
Other Other 30% -A +94D -156D
view details
Other Other 30% -A +94D -156D
view details
Other Other 30% -A +94D -156D
view details
Other Other 30% -A +94D -156D
view details
Other Other 30% -A +94D -156D
view details
Other Other 30% -A +94D -156D
view details
Other Other 30% -A +94D -156D
view details
Other Other 30% -A +94D -156D
view details
Other Other 30% -A +94D -156D
view details
Other Other 30% -A +94D -156D
view details
Other Other 30% -A +94D -156D
view details
Other Other 30% -A +94D -156D
view details
Other Other 30% -A +94D -156D
view details
Other Other 30% -A +94D -156D
view details
Other Other 30% -A +94D -156D
view details
Other Other 30% -A +94D -156D
view details
Other Other 30% -A +94D -156D
view details
Other Other 30% -A +94D -156D
view details
Other Other 30% -A +94D -156D
view details
Other Other 30% -A +94D -156D
view details
Other Other 30% -A +94D -156D
view details
Other Other 30% -A +94D -156D
view details
Other Other 30% -A +94D -156D
view details
Other Other 30% -A +94D -156D
view details
Other Other 30% -A +94D -156D
view details
Other Other 30% -A +94D -156D
view details
Other Other 30% -A +94D -156D
view details
Other Other 30% -A +94D -156D
view details
Other Other 30% -A +94D -156D
view details
Other Other 30% -A +94D -156D
view details
Other Other 30% -A +94D -156D
view details
Other Other 30% -A +94D -156D
view details
Other Other 30% -A +94D -156D
view details
Other Other 30% -A +94D -156D
view details
Other Other 30% -A +94D -156D
Interpreting sequences
Chain A Sequence
MIYSITEIEARYAETDKMGVIYHGNYATWFEVARLDYISKLGFSYADMEKQGIISPVTDLNVNYKKSIFYPEKVKVKTWVEKYSRLRSVYKYEIFNEKGELATTGSTELICIKEDTFKPIRLDRYFPDWHEAYSKVQALNNEGKIVEIMDGIDSL
Chain A Sequence
MIYSITEIEARYAETDKMGVIYHGNYATWFEVARLDYISKLGFSYADMEKQGIISPVTDLNVNYKKSIFYPEKVKVKTWVEKYSRLRSVYKYEIFNEKGELATTGSTELICIKEDTFKPIRLDRYFPDWHEAYSKVQALNNEGKIVEIM
Chain A Sequence
MIYSITEIEARYAETDKMGVIYHGNYATWFEVARLDYISKLGFSYADMEKQGIISPVTDLNVNYKKSIFYPEKVKVKTWVEKYSRLRSVYKYEIFNEKGELATTGSTELICIKEDTFKPIRLDRYFPDWHEAYSKVQALNNEGKIVEIMDGIDSL
Chain A Sequence
MIYSITEIEARYAETDKMGVIYHGNYATWFEVARLDYISKLGFSYADMEKQGIISPVTDLNVNYKKSIFYPEKVKVKTWVEKYSRLRSVYKYEIFNEKGELATTGSTELICIKEDTFKPIRLDRYFPDWHEAYSKVQALNNEGKIVEIM
sequence length 155,149,155,149
structure length 155,149,155,149
publication title High resolution crystal structure of the 4-hydroxybenzoyl Coenzyme-A Thioesterase from Staphylococcus aureus
rcsb
molecule tags Hydrolase
molecule keywords 4-hydroxybenzoyl-CoA thioesterase
source organism Staphylococcus aureus
pdb deposition date2016-08-17
LinkProt deposition date2017-09-02
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling