5LNRABCD

Crystal structure of arabidopsis thaliana pdx1-plp complex
Link type Probability Chain A piercings Chain B piercings Chain C piercings Chain D piercings
view details
Other Other 47% -23A -289B
view details
Other Other 47% -23A -289B
view details
Other Other 47% -23A -289B
view details
Other Other 47% -23A -289B
view details
Other Other 47% -23A -289B
view details
Other Other 47% -23A -289B
view details
Other Other 47% -23A -289B
view details
Other Other 47% -23A -289B
view details
Other Other 47% -23A -289B
view details
Other Other 47% -23A -289B
view details
Other Other 47% -23A -289B
view details
Other Other 47% -23A -289B
view details
Other Other 47% -23A -289B
view details
Other Other 47% -23A -289B
view details
Other Other 47% -23A -289B
view details
Other Other 47% -23A -289B
view details
Other Other 47% -23A -289B
view details
Other Other 47% -23A -289B
view details
Other Other 47% -23A -289B
view details
Other Other 47% -23A -289B
view details
Other Other 47% -23A -289B
view details
Other Other 47% -23A -289B
view details
Other Other 47% -23A -289B
view details
Other Other 47% -23A -289B
view details
Other Other 47% -23A -289B
view details
Other Other 47% -23A -289B
view details
Other Other 47% -23A -289B
view details
Other Other 47% -23A -289B
view details
Other Other 47% -23A -289B
view details
Other Other 47% -23A -289B
view details
Other Other 47% -23A -289B
view details
Other Other 47% -23A -289B
view details
Other Other 47% -23A -289B
view details
Other Other 47% -23A -289B
view details
Other Other 47% -23A -289B
view details
Other Other 47% -23A -289B
view details
Other Other 47% -23A -289B
view details
Other Other 47% -23A -289B
view details
Other Other 47% -23A -289B
Interpreting sequences
Chain A Sequence
SPFSVKVGLAQMLRGGVIMDVVNAEQARIAEEAGACAVMALERVPADIRAQGGVARMSDPQMIKEIKQAVTIPVMAKARIGHFVEAQILEAIGIDYIDESEVLTLADEDHHINKHNFRIPFVCGCRNLGEALRRIREGAAMIRTKGEAGTGNIIEAVRHVRSVNGDIRVLRNMDDDEVFTFAKKLAAPYDLVMQTKQLGRLPVVQFAAGGVATPADAALMMQLGCDGVFVGSGIFKSGDPARRARAIVQAVTHYSDPEMLVEVSCGL
Chain A Sequence
PFSVKVGLAQMLRGGVIMDVVNAEQARIAEEAGACAVMALERVPADIRAQGGVARMSDPQMIKEIKQAVTIPVMAKARIGHFVEAQILEAIGIDYIDESEVLTLADEDHHINKHNFRIPFVCGCRNLGEALRRIREGAAMIRTKGEAGTGNIIEAVRHVRSVNGDIRVLRNMDDDEVFTFAKKLAAPYDLVMQTKQLGRLPVVQFAAGGVATPADAALMMQLGCDGVFVGSGIFKSGDPARRARAIVQAVTHYSDPEMLVEVSCGL
Chain A Sequence
SPFSVKVGLAQMLRGGVIMDVVNAEQARIAEEAGACAVMALERVPADIRAQGGVARMSDPQMIKEIKQAVTIPVMAKARIGHFVEAQILEAIGIDYIDESEVLTLADEDHHINKHNFRIPFVCGCRNLGEALRRIREGAAMIRTKGEAGTGNIIEAVRHVRSVNGDIRVLRNMDDDEVFTFAKKLAAPYDLVMQTKQLGRLPVVQFAAGGVATPADAALMMQLGCDGVFVGSGIFKSGDPARRARAIVQAVTHYSDPEMLVEVSCGL
Chain A Sequence
PFSVKVGLAQMLRGGVIMDVVNAEQARIAEEAGACAVMALERVPADIRAQGGVARMSDPQMIKEIKQAVTIPVMAKARIGHFVEAQILEAIGIDYIDESEVLTLADEDHHINKHNFRIPFVCGCRNLGEALRRIREGAAMIRTKGEAGTGNIIEAVRHVRSVNGDIRVLRNMDDDEVFTFAKKLAAPYDLVMQTKQLGRLPVVQFAAGGVATPADAALMMQLGCDGVFVGSGIFKSGDPARRARAIVQAVTHYSDPEMLVEVSCGL
sequence length 267,266,267,266
structure length 267,266,267,266
publication title Lysine relay mechanism coordinates intermediate transfer in vitamin B6 biosynthesis
doi rcsb
molecule tags Lyase
molecule keywords Pyridoxal 5'-phosphate synthase subunit PDX1.3
source organism Arabidopsis thaliana
pdb deposition date2016-08-06
LinkProt deposition date2017-01-22
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling