5LL6Xacf

Structure of the 40s abce1 post-splitting complex in ribosome recycling and translation initiation
Link type Probability Chain X piercings Chain a piercings Chain c piercings Chain f piercings
view details
Other Other 34% -22f -146f -157X -157X +83f
view details
Other Other 34% -22f -146f -157X -157X +83f
view details
Other Other 34% -22f -146f -157X -157X +83f
view details
Other Other 34% -22f -146f -157X -157X +83f
view details
Other Other 34% -22f -146f -157X -157X +83f
view details
Other Other 34% -22f -146f -157X -157X +83f
view details
Other Other 34% -22f -146f -157X -157X +83f
view details
Other Other 34% -22f -146f -157X -157X +83f
view details
Other Other 34% -22f -146f -157X -157X +83f
view details
Other Other 34% -22f -146f -157X -157X +83f
view details
Other Other 34% -22f -146f -157X -157X +83f
view details
Other Other 34% -22f -146f -157X -157X +83f
view details
Other Other 34% -22f -146f -157X -157X +83f
view details
Other Other 34% -22f -146f -157X -157X +83f
view details
Other Other 34% -22f -146f -157X -157X +83f
view details
Other Other 34% -22f -146f -157X -157X +83f
view details
Other Other 34% -22f -146f -157X -157X +83f
view details
Other Other 34% -22f -146f -157X -157X +83f
view details
Other Other 34% -22f -146f -157X -157X +83f
view details
Other Other 34% -22f -146f -157X -157X +83f
view details
Other Other 34% -22f -146f -157X -157X +83f
view details
Other Other 34% -22f -146f -157X -157X +83f
view details
Other Other 34% -22f -146f -157X -157X +83f
view details
Other Other 34% -22f -146f -157X -157X +83f
view details
Other Other 34% -22f -146f -157X -157X +83f
view details
Other Other 34% -22f -146f -157X -157X +83f
view details
Other Other 34% -22f -146f -157X -157X +83f
view details
Other Other 34% -22f -146f -157X -157X +83f
view details
Other Other 34% -22f -146f -157X -157X +83f
view details
Other Other 34% -22f -146f -157X -157X +83f
view details
Other Other 34% -22f -146f -157X -157X +83f
view details
Other Other 34% -22f -146f -157X -157X +83f
view details
Other Other 34% -22f -146f -157X -157X +83f
view details
Other Other 34% -22f -146f -157X -157X +83f
view details
Other Other 34% -22f -146f -157X -157X +83f
view details
Other Other 34% -22f -146f -157X -157X +83f
Interpreting sequences
Chain X Sequence
STELTVQSERAFQKQPHIFNNPKVKTSKRTKRWYKNAGLGFKTPKTAIEGSYIDKKCPFTGLVSIRGKILTGTVVSTKMHRTIVIRRAYLHYIPKYNRYEKRHKNVPVHVSPAFRVQVGDIVTVGQCRPISKTVRFNVVKVSAAAGKANKQFAKF
Chain X Sequence
MENDKGQLVELYVPRKCSATNRIIKADDHASVQINVAKVDEEGRAIPGEYVTYALSGYVRSRGESDDSLNRLAQNDGLLKNVWSYSR
Chain X Sequence
GKGKPRGLNSARKLRVHRRNNRWAENNYKKRLLGTAFKSSPFGGSSHAKGIVLEKLGIESKQPNSAIRKCVRVQLIKNGKKVTAFVPNDGCLNFVDENDEVLLAGFGRKGKAKGDIPGVRFKVVKVSGVSLLALWKEKKEKPRS
Chain X Sequence
VLVQDLLHPTAASEARKHKLKTLVQGPRSYFLDVKCPGCLNITTVFSHAQTAVTCESCSTILCTPTGGKAKLSEGTSFRRK
sequence length 155,87,144,81
structure length 155,87,144,81
publication title Structure of the 40S-ABCE1 post-splitting complex in ribosome recycling and translation initiation.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 18S ribosomal RNA
pdb deposition date2016-07-26
LinkProt deposition date2017-04-15
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling