5LL6TXcg

Structure of the 40s abce1 post-splitting complex in ribosome recycling and translation initiation
Link type Probability Chain T piercings Chain X piercings Chain c piercings Chain g piercings
view details
Other Other 31% -65X -85X +107X +129X +157X +226c -62c -226g +62g
view details
Other Other 31% -65X -85X +107X +129X +157X +226c -62c -226g +62g
view details
Other Other 31% -65X -85X +107X +129X +157X +226c -62c -226g +62g
view details
Other Other 31% -65X -85X +107X +129X +157X +226c -62c -226g +62g
view details
Other Other 31% -65X -85X +107X +129X +157X +226c -62c -226g +62g
view details
Other Other 31% -65X -85X +107X +129X +157X +226c -62c -226g +62g
view details
Other Other 31% -65X -85X +107X +129X +157X +226c -62c -226g +62g
view details
Other Other 31% -65X -85X +107X +129X +157X +226c -62c -226g +62g
view details
Other Other 31% -65X -85X +107X +129X +157X +226c -62c -226g +62g
view details
Other Other 31% -65X -85X +107X +129X +157X +226c -62c -226g +62g
view details
Other Other 31% -65X -85X +107X +129X +157X +226c -62c -226g +62g
view details
Other Other 31% -65X -85X +107X +129X +157X +226c -62c -226g +62g
view details
Other Other 31% -65X -85X +107X +129X +157X +226c -62c -226g +62g
view details
Other Other 31% -65X -85X +107X +129X +157X +226c -62c -226g +62g
view details
Other Other 31% -65X -85X +107X +129X +157X +226c -62c -226g +62g
view details
Other Other 31% -65X -85X +107X +129X +157X +226c -62c -226g +62g
view details
Other Other 31% -65X -85X +107X +129X +157X +226c -62c -226g +62g
view details
Other Other 31% -65X -85X +107X +129X +157X +226c -62c -226g +62g
view details
Other Other 31% -65X -85X +107X +129X +157X +226c -62c -226g +62g
view details
Other Other 31% -65X -85X +107X +129X +157X +226c -62c -226g +62g
view details
Other Other 31% -65X -85X +107X +129X +157X +226c -62c -226g +62g
view details
Other Other 31% -65X -85X +107X +129X +157X +226c -62c -226g +62g
view details
Other Other 31% -65X -85X +107X +129X +157X +226c -62c -226g +62g
view details
Other Other 31% -65X -85X +107X +129X +157X +226c -62c -226g +62g
view details
Other Other 31% -65X -85X +107X +129X +157X +226c -62c -226g +62g
view details
Other Other 31% -65X -85X +107X +129X +157X +226c -62c -226g +62g
view details
Other Other 31% -65X -85X +107X +129X +157X +226c -62c -226g +62g
view details
Other Other 31% -65X -85X +107X +129X +157X +226c -62c -226g +62g
view details
Other Other 31% -65X -85X +107X +129X +157X +226c -62c -226g +62g
view details
Other Other 31% -65X -85X +107X +129X +157X +226c -62c -226g +62g
view details
Other Other 31% -65X -85X +107X +129X +157X +226c -62c -226g +62g
view details
Other Other 31% -65X -85X +107X +129X +157X +226c -62c -226g +62g
view details
Other Other 31% -65X -85X +107X +129X +157X +226c -62c -226g +62g
view details
Other Other 31% -65X -85X +107X +129X +157X +226c -62c -226g +62g
Interpreting sequences
Chain T Sequence
MKLNISYPVNGSQKTFEIDDEHRIRVFFDKRIGQEVDGEAVGDEFKGYVFKISGGNDKQGFPMKQGVLLPTRIKLLLTKNVSCYRPRRDGERKRKSVRGAIVGPDLAVLALVIVKKGEQELEGLTDTTVPKRLGPKRANNIRKFFGLSKEDDVRDFVIRREVTKGEKTYTKAPKIQRLVTPQRLQRKRHQRALKVRNAQAQREAAAEYAQLLAKRLSERKAEKAEI
Chain T Sequence
STELTVQSERAFQKQPHIFNNPKVKTSKRTKRWYKNAGLGFKTPKTAIEGSYIDKKCPFTGLVSIRGKILTGTVVSTKMHRTIVIRRAYLHYIPKYNRYEKRHKNVPVHVSPAFRVQVGDIVTVGQCRPISKTVRFNVVKVSAAAGKANKQFAKF
Chain T Sequence
GKGKPRGLNSARKLRVHRRNNRWAENNYKKRLLGTAFKSSPFGGSSHAKGIVLEKLGIESKQPNSAIRKCVRVQLIKNGKKVTAFVPNDGCLNFVDENDEVLLAGFGRKGKAKGDIPGVRFKVVKVSGVSLLALWKEKKEKPRS
Chain T Sequence
AKVHGSLARAGKVKSQTPKVEKTEKPKKPKGRAYKRLLYTRRFVNVTLVNGKRRMNPGPS
sequence length 226,155,144,60
structure length 226,155,144,60
publication title Structure of the 40S-ABCE1 post-splitting complex in ribosome recycling and translation initiation.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 18S ribosomal RNA
pdb deposition date2016-07-26
LinkProt deposition date2017-04-15
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling