5LAICKOW

Ligand-induced aziridine-formation at the yeast proteasomal subunit beta5 by sulfonate esters
Link type Probability Chain C piercings Chain K piercings Chain O piercings Chain W piercings
view details
Other Other 34% -212K -213K -116O -241O +204W
view details
Other Other 34% -212K -213K -116O -241O +204W
view details
Other Other 34% -212K -213K -116O -241O +204W
view details
Other Other 34% -212K -213K -116O -241O +204W
view details
Other Other 34% -212K -213K -116O -241O +204W
view details
Other Other 34% -212K -213K -116O -241O +204W
view details
Other Other 34% -212K -213K -116O -241O +204W
view details
Other Other 34% -212K -213K -116O -241O +204W
view details
Other Other 34% -212K -213K -116O -241O +204W
view details
Other Other 34% -212K -213K -116O -241O +204W
view details
Other Other 34% -212K -213K -116O -241O +204W
view details
Other Other 34% -212K -213K -116O -241O +204W
view details
Other Other 34% -212K -213K -116O -241O +204W
view details
Other Other 34% -212K -213K -116O -241O +204W
view details
Other Other 34% -212K -213K -116O -241O +204W
view details
Other Other 34% -212K -213K -116O -241O +204W
view details
Other Other 34% -212K -213K -116O -241O +204W
view details
Other Other 34% -212K -213K -116O -241O +204W
view details
Other Other 34% -212K -213K -116O -241O +204W
view details
Other Other 34% -212K -213K -116O -241O +204W
view details
Other Other 34% -212K -213K -116O -241O +204W
view details
Other Other 34% -212K -213K -116O -241O +204W
view details
Other Other 34% -212K -213K -116O -241O +204W
view details
Other Other 34% -212K -213K -116O -241O +204W
view details
Other Other 34% -212K -213K -116O -241O +204W
view details
Other Other 34% -212K -213K -116O -241O +204W
view details
Other Other 34% -212K -213K -116O -241O +204W
view details
Other Other 34% -212K -213K -116O -241O +204W
view details
Other Other 34% -212K -213K -116O -241O +204W
view details
Other Other 34% -212K -213K -116O -241O +204W
view details
Other Other 34% -212K -213K -116O -241O +204W
view details
Other Other 34% -212K -213K -116O -241O +204W
view details
Other Other 34% -212K -213K -116O -241O +204W
view details
Other Other 34% -212K -213K -116O -241O +204W
view details
Other Other 34% -212K -213K -116O -241O +204W
view details
Other Other 34% -212K -213K -116O -241O +204W
view details
Other Other 34% -212K -213K -116O -241O +204W
view details
Other Other 34% -212K -213K -116O -241O +204W
Interpreting sequences
Chain C Sequence
GYDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSKVSKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQSGGVRPFGVSTLIAGFDPRDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNYDRKEPPATVEECVKLTVRSLLEVVQTGAKNIEITVVKPDSDIVALSSEEINQYVTQIEQEKQE
Chain C Sequence
TTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWETWLGSQCRLHELREKERISVAAASKILSNLVYQYKGAGLSMGTMICGYTRKEGPTIYYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSVEDALYLGKRSILAAAHRDAYSGGSVNLYHVTEDGWIYHGNHDVGELFWKVKEEEGSFNNVIG
Chain C Sequence
MTDRYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLAMSETLSKVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTSYKRIYGEYPPTKLLVSEVAKIMQEATQSGGVRPFGVSLLIAGHDEFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDELELEDAIHIALLTLKESVEGEFNGDTIELAIIGDENPDLLGYTGIPTDKGPRFRKLTSQEINDRLEAL
Chain C Sequence
SDPSSINGGIVVAMTGKDCVAIACDLRLGSQSLGVSNKFEKIFHYGHVFLGITGLATDVTTLNEMFRYKTNLYKLKEERAIEPETFTQLVSSSLYERRFGPYFVGPVVAGINSKSGKPFIAGFDLIGCIDEAKDFIVSGTASDQLFGMCESLYEPNLEPEDLFETISQALLNAADRDALSGWGAVVYIIKKDEVVKRYLKMRQD
sequence length 240,211,250,204
structure length 240,211,250,204
publication title Tunable Probes with Direct Fluorescence Signals for the Constitutive and Immunoproteasome.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Proteasome subunit alpha type-2
pdb deposition date2016-06-14
LinkProt deposition date2017-04-29
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling