| Link type | Probability | Chain C piercings | Chain K piercings | Chain O piercings | Chain W piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
|
Other | 34% | -212K -213K -116O -241O | +204W | ||||||||||
| view details |
|
Other | 34% | -212K -213K -116O -241O | +204W | ||||||||||
| view details |
|
Other | 34% | -212K -213K -116O -241O | +204W | ||||||||||
| view details |
|
Other | 34% | -212K -213K -116O -241O | +204W | ||||||||||
| view details |
|
Other | 34% | -212K -213K -116O -241O | +204W | ||||||||||
| view details |
|
Other | 34% | -212K -213K -116O -241O | +204W | ||||||||||
| view details |
|
Other | 34% | -212K -213K -116O -241O | +204W | ||||||||||
| view details |
|
Other | 34% | -212K -213K -116O -241O | +204W | ||||||||||
| view details |
|
Other | 34% | -212K -213K -116O -241O | +204W | ||||||||||
| view details |
|
Other | 34% | -212K -213K -116O -241O | +204W | ||||||||||
| view details |
|
Other | 34% | -212K -213K -116O -241O | +204W | ||||||||||
| view details |
|
Other | 34% | -212K -213K -116O -241O | +204W | ||||||||||
| view details |
|
Other | 34% | -212K -213K -116O -241O | +204W | ||||||||||
| view details |
|
Other | 34% | -212K -213K -116O -241O | +204W | ||||||||||
| view details |
|
Other | 34% | -212K -213K -116O -241O | +204W | ||||||||||
| view details |
|
Other | 34% | -212K -213K -116O -241O | +204W | ||||||||||
| view details |
|
Other | 34% | -212K -213K -116O -241O | +204W | ||||||||||
| view details |
|
Other | 34% | -212K -213K -116O -241O | +204W | ||||||||||
| view details |
|
Other | 34% | -212K -213K -116O -241O | +204W | ||||||||||
| view details |
|
Other | 34% | -212K -213K -116O -241O | +204W | ||||||||||
| view details |
|
Other | 34% | -212K -213K -116O -241O | +204W | ||||||||||
| view details |
|
Other | 34% | -212K -213K -116O -241O | +204W | ||||||||||
| view details |
|
Other | 34% | -212K -213K -116O -241O | +204W | ||||||||||
| view details |
|
Other | 34% | -212K -213K -116O -241O | +204W | ||||||||||
| view details |
|
Other | 34% | -212K -213K -116O -241O | +204W | ||||||||||
| view details |
|
Other | 34% | -212K -213K -116O -241O | +204W | ||||||||||
| view details |
|
Other | 34% | -212K -213K -116O -241O | +204W | ||||||||||
| view details |
|
Other | 34% | -212K -213K -116O -241O | +204W | ||||||||||
| view details |
|
Other | 34% | -212K -213K -116O -241O | +204W | ||||||||||
| view details |
|
Other | 34% | -212K -213K -116O -241O | +204W | ||||||||||
| view details |
|
Other | 34% | -212K -213K -116O -241O | +204W | ||||||||||
| view details |
|
Other | 34% | -212K -213K -116O -241O | +204W | ||||||||||
| view details |
|
Other | 34% | -212K -213K -116O -241O | +204W | ||||||||||
| view details |
|
Other | 34% | -212K -213K -116O -241O | +204W | ||||||||||
| view details |
|
Other | 34% | -212K -213K -116O -241O | +204W | ||||||||||
| view details |
|
Other | 34% | -212K -213K -116O -241O | +204W | ||||||||||
| view details |
|
Other | 34% | -212K -213K -116O -241O | +204W | ||||||||||
| view details |
|
Other | 34% | -212K -213K -116O -241O | +204W | ||||||||||
Chain C Sequence |
GYDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSKVSKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQSGGVRPFGVSTLIAGFDPRDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNYDRKEPPATVEECVKLTVRSLLEVVQTGAKNIEITVVKPDSDIVALSSEEINQYVTQIEQEKQE |
Chain C Sequence |
TTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWETWLGSQCRLHELREKERISVAAASKILSNLVYQYKGAGLSMGTMICGYTRKEGPTIYYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSVEDALYLGKRSILAAAHRDAYSGGSVNLYHVTEDGWIYHGNHDVGELFWKVKEEEGSFNNVIG |
Chain C Sequence |
MTDRYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLAMSETLSKVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTSYKRIYGEYPPTKLLVSEVAKIMQEATQSGGVRPFGVSLLIAGHDEFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDELELEDAIHIALLTLKESVEGEFNGDTIELAIIGDENPDLLGYTGIPTDKGPRFRKLTSQEINDRLEAL |
Chain C Sequence |
SDPSSINGGIVVAMTGKDCVAIACDLRLGSQSLGVSNKFEKIFHYGHVFLGITGLATDVTTLNEMFRYKTNLYKLKEERAIEPETFTQLVSSSLYERRFGPYFVGPVVAGINSKSGKPFIAGFDLIGCIDEAKDFIVSGTASDQLFGMCESLYEPNLEPEDLFETISQALLNAADRDALSGWGAVVYIIKKDEVVKRYLKMRQD |
| sequence length | 240,211,250,204 |
| structure length | 240,211,250,204 |
| publication title |
Tunable Probes with Direct Fluorescence Signals for the Constitutive and Immunoproteasome.
pubmed doi rcsb |
| molecule tags | Hydrolase |
| molecule keywords | Proteasome subunit alpha type-2 |
| pdb deposition date | 2016-06-14 |
| LinkProt deposition date | 2017-04-29 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...