5KSUABDE

Crystal structure of hla-dq2.5-clip1 at 2.73 resolution
A: 52-54 B: 104-113 D: 52-54 E: 104-113
Link type Probability Chain A piercings Chain B piercings Chain D piercings Chain E piercings
view details
Other Other 49% -8B -12B +27B -40B -68B -5D -83D -182D -7A +91A -103A -181A -190B -191B +13E -28E
view details
Other Other 49% -8B -12B +27B -40B -68B -5D -83D -182D -7A +91A -103A -181A -190B -191B +13E -28E
view details
Other Other 49% -8B -12B +27B -40B -68B -5D -83D -182D -7A +91A -103A -181A -190B -191B +13E -28E
view details
Other Other 49% -8B -12B +27B -40B -68B -5D -83D -182D -7A +91A -103A -181A -190B -191B +13E -28E
view details
Other Other 49% -8B -12B +27B -40B -68B -5D -83D -182D -7A +91A -103A -181A -190B -191B +13E -28E
view details
Other Other 49% -8B -12B +27B -40B -68B -5D -83D -182D -7A +91A -103A -181A -190B -191B +13E -28E
view details
Other Other 49% -8B -12B +27B -40B -68B -5D -83D -182D -7A +91A -103A -181A -190B -191B +13E -28E
view details
Other Other 49% -8B -12B +27B -40B -68B -5D -83D -182D -7A +91A -103A -181A -190B -191B +13E -28E
view details
Other Other 49% -8B -12B +27B -40B -68B -5D -83D -182D -7A +91A -103A -181A -190B -191B +13E -28E
view details
Other Other 49% -8B -12B +27B -40B -68B -5D -83D -182D -7A +91A -103A -181A -190B -191B +13E -28E
view details
Other Other 49% -8B -12B +27B -40B -68B -5D -83D -182D -7A +91A -103A -181A -190B -191B +13E -28E
view details
Other Other 49% -8B -12B +27B -40B -68B -5D -83D -182D -7A +91A -103A -181A -190B -191B +13E -28E
view details
Other Other 49% -8B -12B +27B -40B -68B -5D -83D -182D -7A +91A -103A -181A -190B -191B +13E -28E
view details
Other Other 49% -8B -12B +27B -40B -68B -5D -83D -182D -7A +91A -103A -181A -190B -191B +13E -28E
view details
Other Other 49% -8B -12B +27B -40B -68B -5D -83D -182D -7A +91A -103A -181A -190B -191B +13E -28E
view details
Other Other 49% -8B -12B +27B -40B -68B -5D -83D -182D -7A +91A -103A -181A -190B -191B +13E -28E
view details
Other Other 49% -8B -12B +27B -40B -68B -5D -83D -182D -7A +91A -103A -181A -190B -191B +13E -28E
view details
Other Other 49% -8B -12B +27B -40B -68B -5D -83D -182D -7A +91A -103A -181A -190B -191B +13E -28E
view details
Other Other 49% -8B -12B +27B -40B -68B -5D -83D -182D -7A +91A -103A -181A -190B -191B +13E -28E
view details
Other Other 49% -8B -12B +27B -40B -68B -5D -83D -182D -7A +91A -103A -181A -190B -191B +13E -28E
view details
Other Other 49% -8B -12B +27B -40B -68B -5D -83D -182D -7A +91A -103A -181A -190B -191B +13E -28E
view details
Other Other 49% -8B -12B +27B -40B -68B -5D -83D -182D -7A +91A -103A -181A -190B -191B +13E -28E
view details
Other Other 49% -8B -12B +27B -40B -68B -5D -83D -182D -7A +91A -103A -181A -190B -191B +13E -28E
view details
Other Other 49% -8B -12B +27B -40B -68B -5D -83D -182D -7A +91A -103A -181A -190B -191B +13E -28E
view details
Other Other 49% -8B -12B +27B -40B -68B -5D -83D -182D -7A +91A -103A -181A -190B -191B +13E -28E
Interpreting sequences
Chain A Sequence
DIVADHVASYGVNLYQSYGPSGQYTHEFDGDEQFYVDLGRKETVWCLPVLRQF-RFDPQFALTNIAVLKHNLNSLIKRSNSTAATNEVPEVTVFSKSPVTLGQPNILICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTLLPSAEESYDCKVEHWGLDKPLLKHWEPE
Chain A Sequence
SPEDFVYQFKGMCYFTNGTERVRLVSRSIYNREEIVRFDSDVGEFRAVTLLGLPAAEYWNSQKDILERKRAAVDRVCRHNYQLELRTTLQRRVEPTVTISPS--------NLLVCSVTDFYPAQIKVRWFRNDQEETAGVVSTPLIRNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQSPITVEWRA
Chain A Sequence
DIVADHVASYGVNLYQSYGPSGQYTHEFDGDEQFYVDLGRKETVWCLPVLRQF-RFDPQFALTNIAVLKHNLNSLIKRSNSTAATNEVPEVTVFSKSPVTLGQPNILICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTLLPSAEESYDCKVEHWGLDKPLLKHWEPE
Chain A Sequence
SPEDFVYQFKGMCYFTNGTERVRLVSRSIYNREEIVRFDSDVGEFRAVTLLGLPAAEYWNSQKDILERKRAAVDRVCRHNYQLELRTTLQRRVEPTVTISPS--------NLLVCSVTDFYPAQIKVRWFRNDQEETAGVVSTPLIRNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQSPITVEWR
sequence length 182,188,182,187
structure length 182,180,182,179
publication title Structural Basis for the class-II-associated invariant chain peptide-rich Phenotype of Human Leukocyte Antigen DQ2.5
doi rcsb
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DQ alpha 1 chain
source organism Homo sapiens
missing residues A: 52-54 B: 104-113 D: 52-54 E: 104-113
pdb deposition date2016-07-10
LinkProt deposition date2017-04-10
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling