5KGNABCD

1.95a resolution structure of independent phosphoglycerate mutase from c. elegans in complex with a macrocyclic peptide inhibitor (2d)
Link type Probability Chain A piercings Chain B piercings Chain C piercings Chain D piercings
view details
Other Other 33% +12D +96A +526A -550A
view details
Other Other 33% +12D +96A +526A -550A
view details
Other Other 33% +12D +96A +526A -550A
view details
Other Other 33% +12D +96A +526A -550A
view details
Other Other 33% +12D +96A +526A -550A
view details
Other Other 33% +12D +96A +526A -550A
view details
Other Other 33% +12D +96A +526A -550A
view details
Other Other 33% +12D +96A +526A -550A
view details
Other Other 33% +12D +96A +526A -550A
view details
Other Other 33% +12D +96A +526A -550A
view details
Other Other 33% +12D +96A +526A -550A
view details
Other Other 33% +12D +96A +526A -550A
view details
Other Other 33% +12D +96A +526A -550A
view details
Other Other 33% +12D +96A +526A -550A
view details
Other Other 33% +12D +96A +526A -550A
view details
Other Other 33% +12D +96A +526A -550A
view details
Other Other 33% +12D +96A +526A -550A
view details
Other Other 33% +12D +96A +526A -550A
view details
Other Other 33% +12D +96A +526A -550A
view details
Other Other 33% +12D +96A +526A -550A
view details
Other Other 33% +12D +96A +526A -550A
view details
Other Other 33% +12D +96A +526A -550A
view details
Other Other 33% +12D +96A +526A -550A
view details
Other Other 33% +12D +96A +526A -550A
view details
Other Other 33% +12D +96A +526A -550A
view details
Other Other 33% +12D +96A +526A -550A
view details
Other Other 33% +12D +96A +526A -550A
view details
Other Other 33% +12D +96A +526A -550A
view details
Other Other 33% +12D +96A +526A -550A
view details
Other Other 33% +12D +96A +526A -550A
view details
Other Other 33% +12D +96A +526A -550A
view details
Other Other 33% +12D +96A +526A -550A
view details
Other Other 33% +12D +96A +526A -550A
view details
Other Other 33% +12D +96A +526A -550A
view details
Other Other 33% +12D +96A +526A -550A
view details
Other Other 33% +12D +96A +526A -550A
view details
Other Other 33% +12D +96A +526A -550A
view details
Other Other 33% +12D +96A +526A -550A
view details
Other Other 33% +12D +96A +526A -550A
view details
Other Other 33% +12D +96A +526A -550A
view details
Other Other 33% +12D +96A +526A -550A
view details
Other Other 33% +12D +96A +526A -550A
view details
Other Other 33% +12D +96A +526A -550A
view details
Other Other 33% +12D +96A +526A -550A
view details
Other Other 33% +12D +96A +526A -550A
view details
Other Other 33% +12D +96A +526A -550A
view details
Other Other 33% +12D +96A +526A -550A
view details
Other Other 33% +12D +96A +526A -550A
Interpreting sequences
Chain A Sequence
AMANNSSVANKVCLIVIDGWGVSEDPYGNAILNAQTPVMDKLCSGNWAQIEAHGLHVGLPEGLMGNSEVGHLNIGAGRVIYQDIVRINLAVKNNKFVTNESLVDACDRAKNGNGRLHLAGLVSDGGVHSHIDHMFALVKAIKELGVPELYLHFYGDGRDTSPNSGVGFLEQTLEFLEKTTGYGKLATVVGRYYAMDRDNRWERINVAYEAMIGGVGETSDEAGVVEVVRKRYAADETDEFLKPIILQGEKGRVQNDDTIIFFDYRADRMREISAAMGMDRYKDCNSKLAHPSNLQVYGMTQYKAEFPFKSLFPPASNKNVLAEWLAEQKVSQFHCAETEKYAHVTFFFNGGLEKQFEGEERCLVPSPKVATYDLQPEMSAAGVADKMIEQLEAGTHPFIMCNFAPPDMVGHTGVYEAAVKACEATDIAIGRIYEATQKHGYSLMVTADHGNAEKMKAPDGGKHTAHTCYRVPLTLSHPGFKFVDPADRHPALCDVAPTVLAIMGLPQPAEMTGVSIVQKIKLAAALEHHH
Chain A Sequence
MAMANNSSVANKVCLIVIDGWGVSEDPYGNAILNAQTPVMDKLCSGNWAQIEAHGLHVGLPEGLMGNSEVGHLNIGAGRVIYQDIVRINLAVKNNKFVTNESLVDACDRAKNGNGRLHLAGLVSDGGVHSHIDHMFALVKAIKELGVPELYLHFYGDGRDTSPNSGVGFLEQTLEFLEKTTGYGKLATVVGRYYAMDRDNRWERINVAYEAMIGGVGETSDEAGVVEVVRKRYAADETDEFLKPIILQGEKGRVQNDDTIIFFDYRADRMREISAAMGMDRYKDCNSKLAHPSNLQVYGMTQYKAEFPFKSLFPPASNKNVLAEWLAEQKVSQFHCAETEKYAHVTFFFNGGLEKQFEGEERCLVPSPKVATYDLQPEMSAAGVADKMIEQLEAGTHPFIMCNFAPPDMVGHTGVYEAAVKACEATDIAIGRIYEATQKHGYSLMVTADHGNAEKMKAPDGGKHTAHTCYRVPLTLSHPGFKFVDPADRHPALCDVAPTVLAIMGLPQPAEMTGVSIVQKI
Chain A Sequence
DYPGDYCYLY
Chain A Sequence
DYPGDYCYLY
sequence length 530,521,10,10
structure length 530,521,10,10
publication title Macrocycle peptides delineate locked-open inhibition mechanism for microorganism phosphoglycerate mutases
rcsb
molecule tags Isomerase
molecule keywords 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
source organism Caenorhabditis elegans
pdb deposition date2016-06-13
LinkProt deposition date2017-04-10
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling