5KERABCD

Deer mouse recombinant hemoglobin from high altitude species
Link type Probability Chain A piercings Chain B piercings Chain C piercings Chain D piercings
view details
Other Other 35% -147B -141C +114D +141D +141A +141A -122A -146B
view details
Other Other 35% -147B -141C +114D +141D +141A +141A -122A -146B
view details
Other Other 35% -147B -141C +114D +141D +141A +141A -122A -146B
view details
Other Other 35% -147B -141C +114D +141D +141A +141A -122A -146B
view details
Other Other 35% -147B -141C +114D +141D +141A +141A -122A -146B
view details
Other Other 35% -147B -141C +114D +141D +141A +141A -122A -146B
view details
Other Other 35% -147B -141C +114D +141D +141A +141A -122A -146B
view details
Other Other 35% -147B -141C +114D +141D +141A +141A -122A -146B
view details
Other Other 35% -147B -141C +114D +141D +141A +141A -122A -146B
view details
Other Other 35% -147B -141C +114D +141D +141A +141A -122A -146B
view details
Other Other 35% -147B -141C +114D +141D +141A +141A -122A -146B
view details
Other Other 35% -147B -141C +114D +141D +141A +141A -122A -146B
view details
Other Other 35% -147B -141C +114D +141D +141A +141A -122A -146B
view details
Other Other 35% -147B -141C +114D +141D +141A +141A -122A -146B
view details
Other Other 35% -147B -141C +114D +141D +141A +141A -122A -146B
view details
Other Other 35% -147B -141C +114D +141D +141A +141A -122A -146B
view details
Other Other 35% -147B -141C +114D +141D +141A +141A -122A -146B
view details
Other Other 35% -147B -141C +114D +141D +141A +141A -122A -146B
view details
Other Other 35% -147B -141C +114D +141D +141A +141A -122A -146B
view details
Other Other 35% -147B -141C +114D +141D +141A +141A -122A -146B
view details
Other Other 35% -147B -141C +114D +141D +141A +141A -122A -146B
view details
Other Other 35% -147B -141C +114D +141D +141A +141A -122A -146B
view details
Other Other 35% -147B -141C +114D +141D +141A +141A -122A -146B
view details
Other Other 35% -147B -141C +114D +141D +141A +141A -122A -146B
view details
Other Other 35% -147B -141C +114D +141D +141A +141A -122A -146B
view details
Other Other 35% -147B -141C +114D +141D +141A +141A -122A -146B
view details
Other Other 35% -147B -141C +114D +141D +141A +141A -122A -146B
view details
Other Other 35% -147B -141C +114D +141D +141A +141A -122A -146B
view details
Other Other 35% -147B -141C +114D +141D +141A +141A -122A -146B
view details
Other Other 35% -147B -141C +114D +141D +141A +141A -122A -146B
view details
Other Other 35% -147B -141C +114D +141D +141A +141A -122A -146B
view details
Other Other 35% -147B -141C +114D +141D +141A +141A -122A -146B
view details
Other Other 35% -147B -141C +114D +141D +141A +141A -122A -146B
view details
Other Other 35% -147B -141C +114D +141D +141A +141A -122A -146B
view details
Other Other 35% -147B -141C +114D +141D +141A +141A -122A -146B
view details
Other Other 35% -147B -141C +114D +141D +141A +141A -122A -146B
view details
Other Other 35% -147B -141C +114D +141D +141A +141A -122A -146B
view details
Other Other 35% -147B -141C +114D +141D +141A +141A -122A -146B
view details
Other Other 35% -147B -141C +114D +141D +141A +141A -122A -146B
view details
Other Other 35% -147B -141C +114D +141D +141A +141A -122A -146B
view details
Other Other 35% -147B -141C +114D +141D +141A +141A -122A -146B
view details
Other Other 35% -147B -141C +114D +141D +141A +141A -122A -146B
view details
Other Other 35% -147B -141C +114D +141D +141A +141A -122A -146B
Interpreting sequences
Chain A Sequence
VLSADDKANIKAAWGKIGGHGAEYGAEALERMFCSFPTTKTYFPHFDVSPGSAQVKGHGAKVAGALATAASHLDDLPAALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHHPAEFTPAVHASLDKFLASVSTVLTSKY
Chain A Sequence
VHLTDAEKALVTGLWGKVKPEEIGGEALGRLLAVYPWTQRFFDSFGDLSSASAIMGNAKVKGHGKKVIDSFGEGLKHLDNLKGTFASLSELHCDKLHVDPENFKLLGNMIVIVMAHHLGKDFTPAAQAAYQKVVAGVATALAHKYH
Chain A Sequence
VLSADDKANIKAAWGKIGGHGAEYGAEALERMFCSFPTTKTYFPHFDVSPGSAQVKGHGAKVAGALATAASHLDDLPAALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHHPAEFTPAVHASLDKFLASVSTVLTSKY
Chain A Sequence
VHLTDAEKALVTGLWGKVKPEEIGGEALGRLLAVYPWTQRFFDSFGDLSSASAIMGNAKVKGHGKKVIDSFGEGLKHLDNLKGTFASLSELHCDKLHVDPENFKLLGNMIVIVMAHHLGKDFTPAAQAAYQKVVAGVATALAHKYH
sequence length 140,146,140,146
structure length 140,146,140,146
publication title Deer mouse recombinant hemoglobin from highland species
rcsb
molecule tags Transport protein
molecule keywords Alpha-globin
source organism Peromyscus maniculatus
pdb deposition date2016-06-10
LinkProt deposition date2017-04-10
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling