5KEMAFI

Ebov sgp in complex with variable fab domains of iggs c13c6 and bdbv91
Link type Probability Chain A piercings Chain F piercings Chain I piercings
view details
Hopf.2 U Ring Hopf.2 U Ring 33% -69F +159F -60I +285I -113A -285I
view details
Hopf.2 U Ring Hopf.2 U Ring 33% -69F +159F -60I +285I -113A -285I
view details
Hopf.2 U Ring Hopf.2 U Ring 33% -69F +159F -60I +285I -113A -285I
view details
Hopf.2 U Ring Hopf.2 U Ring 33% -69F +159F -60I +285I -113A -285I
view details
Hopf.2 U Ring Hopf.2 U Ring 33% -69F +159F -60I +285I -113A -285I
view details
Hopf.2 U Ring Hopf.2 U Ring 33% -69F +159F -60I +285I -113A -285I
view details
Hopf.2 U Ring Hopf.2 U Ring 33% -69F +159F -60I +285I -113A -285I
view details
Hopf.2 U Ring Hopf.2 U Ring 33% -69F +159F -60I +285I -113A -285I
view details
Hopf.2 U Ring Hopf.2 U Ring 33% -69F +159F -60I +285I -113A -285I
view details
Hopf.2 U Ring Hopf.2 U Ring 33% -69F +159F -60I +285I -113A -285I
view details
Hopf.2 U Ring Hopf.2 U Ring 33% -69F +159F -60I +285I -113A -285I
view details
Hopf.2 U Ring Hopf.2 U Ring 33% -69F +159F -60I +285I -113A -285I
view details
Hopf.2 U Ring Hopf.2 U Ring 33% -69F +159F -60I +285I -113A -285I
view details
Hopf.2 U Ring Hopf.2 U Ring 33% -69F +159F -60I +285I -113A -285I
view details
Hopf.2 U Ring Hopf.2 U Ring 33% -69F +159F -60I +285I -113A -285I
view details
Hopf.2 U Ring Hopf.2 U Ring 33% -69F +159F -60I +285I -113A -285I
view details
Hopf.2 U Ring Hopf.2 U Ring 33% -69F +159F -60I +285I -113A -285I
view details
Hopf.2 U Ring Hopf.2 U Ring 33% -69F +159F -60I +285I -113A -285I
view details
Hopf.2 U Ring Hopf.2 U Ring 33% -69F +159F -60I +285I -113A -285I
view details
Hopf.2 U Ring Hopf.2 U Ring 33% -69F +159F -60I +285I -113A -285I
view details
Hopf.2 U Ring Hopf.2 U Ring 33% -69F +159F -60I +285I -113A -285I
view details
Hopf.2 U Ring Hopf.2 U Ring 33% -69F +159F -60I +285I -113A -285I
view details
Hopf.2 U Ring Hopf.2 U Ring 33% -69F +159F -60I +285I -113A -285I
view details
Hopf.2 U Ring Hopf.2 U Ring 33% -69F +159F -60I +285I -113A -285I
view details
Hopf.2 U Ring Hopf.2 U Ring 33% -69F +159F -60I +285I -113A -285I
view details
Hopf.2 U Ring Hopf.2 U Ring 33% -69F +159F -60I +285I -113A -285I
view details
Hopf.2 U Ring Hopf.2 U Ring 33% -69F +159F -60I +285I -113A -285I
view details
Hopf.2 U Ring Hopf.2 U Ring 33% -69F +159F -60I +285I -113A -285I
view details
Hopf.2 U Ring Hopf.2 U Ring 33% -69F +159F -60I +285I -113A -285I
view details
Hopf.2 U Ring Hopf.2 U Ring 33% -69F +159F -60I +285I -113A -285I
Interpreting sequences
Chain A Sequence
CRDKLSSTNQLRSVGLNLEGNGVATDVPSATKRWGFRSGVPPKVVNYEAGEWAENCYNLEIKKPDGSECLPAAPDGIRGFPRCRYVHKVSGTGPCAGDFAFHKEGAFFLYDRLASTVIYRGTTFAEGVVAFLILPQAKKDFFSSHPLREPVNATEDPSSGYYSTTIRYQATGFGTNETEYLFEVDNLTYVQLESRFTPQFLLQLNETIYTSGKRSNTTGKLIWKVNPEIDTT
Chain A Sequence
CRDKLSSTNQLRSVGLNLEGNGVATDVPSATKRWGFRSGVPPKVVNYEAGEWAENCYNLEIKKPDGSECLPAAPDGIRGFPRCRYVHKVSGTGPCAGDFAFHKEGAFFLYDRLASTVIYRGTTFAEGVVAFLILPQAKKDFFSSHPLREPVNATEDPSSGYYSTTIRYQATGFGTNETEYLFEVDNLTYVQLESRFTPQFLLQLNETIYTSGKRSNTTGKLIWKVNPEIDTT
Chain A Sequence
DVKLLESGGGLVQPGGSLKLSCAASGFSLSTSGVGVGWFRQPSGKGLEWLALIWWDDDKYYNPSLKSQLSISKDFSRNQVFLKISNVDIADTATYYCARRDPFGYDNAMGYWGQGTSVTVS
sequence length 232,232,121
structure length 232,232,121
publication title Structures of Ebola virus GP and sGP in complex with therapeutic antibodies.
pubmed doi rcsb
molecule tags Viral protein/immune system
molecule keywords BDBV91 variable Fab domain light chain
source organism Homo sapiens
pdb deposition date2016-06-09
LinkProt deposition date2016-09-14
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling