| Link type | Probability | Chain B piercings | Chain G piercings | Chain I piercings | Chain T piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Other | 37% | -616G -615I -616T | -615B | +616B +614G | |||||||||
| view details |
|
Other | 37% | -616G -615I -616T | -615B | +616B +614G | |||||||||
| view details |
|
Other | 37% | -616G -615I -616T | -615B | +616B +614G | |||||||||
| view details |
|
Other | 37% | -616G -615I -616T | -615B | +616B +614G | |||||||||
| view details |
|
Other | 37% | -616G -615I -616T | -615B | +616B +614G | |||||||||
| view details |
|
Other | 37% | -616G -615I -616T | -615B | +616B +614G | |||||||||
| view details |
|
Other | 37% | -616G -615I -616T | -615B | +616B +614G | |||||||||
| view details |
|
Other | 37% | -616G -615I -616T | -615B | +616B +614G | |||||||||
| view details |
|
Other | 37% | -616G -615I -616T | -615B | +616B +614G | |||||||||
| view details |
|
Other | 37% | -616G -615I -616T | -615B | +616B +614G | |||||||||
| view details |
|
Other | 37% | -616G -615I -616T | -615B | +616B +614G | |||||||||
| view details |
|
Other | 37% | -616G -615I -616T | -615B | +616B +614G | |||||||||
| view details |
|
Other | 37% | -616G -615I -616T | -615B | +616B +614G | |||||||||
| view details |
|
Other | 37% | -616G -615I -616T | -615B | +616B +614G | |||||||||
| view details |
|
Other | 37% | -616G -615I -616T | -615B | +616B +614G | |||||||||
| view details |
|
Other | 37% | -616G -615I -616T | -615B | +616B +614G | |||||||||
| view details |
|
Other | 37% | -616G -615I -616T | -615B | +616B +614G | |||||||||
| view details |
|
Other | 37% | -616G -615I -616T | -615B | +616B +614G | |||||||||
| view details |
|
Other | 37% | -616G -615I -616T | -615B | +616B +614G | |||||||||
| view details |
|
Other | 37% | -616G -615I -616T | -615B | +616B +614G | |||||||||
| view details |
|
Other | 37% | -616G -615I -616T | -615B | +616B +614G | |||||||||
| view details |
|
Other | 37% | -616G -615I -616T | -615B | +616B +614G | |||||||||
| view details |
|
Other | 37% | -616G -615I -616T | -615B | +616B +614G | |||||||||
| view details |
|
Other | 37% | -616G -615I -616T | -615B | +616B +614G | |||||||||
| view details |
|
Other | 37% | -616G -615I -616T | -615B | +616B +614G | |||||||||
| view details |
|
Other | 37% | -616G -615I -616T | -615B | +616B +614G | |||||||||
| view details |
|
Other | 37% | -616G -615I -616T | -615B | +616B +614G | |||||||||
| view details |
|
Other | 37% | -616G -615I -616T | -615B | +616B +614G | |||||||||
| view details |
|
Other | 37% | -616G -615I -616T | -615B | +616B +614G | |||||||||
| view details |
|
Other | 37% | -616G -615I -616T | -615B | +616B +614G | |||||||||
| view details |
|
Other | 37% | -616G -615I -616T | -615B | +616B +614G | |||||||||
| view details |
|
Other | 37% | -616G -615I -616T | -615B | +616B +614G | |||||||||
| view details |
|
Other | 37% | -616G -615I -616T | -615B | +616B +614G | |||||||||
| view details |
|
Other | 37% | -616G -615I -616T | -615B | +616B +614G | |||||||||
| view details |
|
Other | 37% | -616G -615I -616T | -615B | +616B +614G | |||||||||
Chain B Sequence |
AIVNAQPKCNPNLHYWTTQDEGAAIGLAWIPYFGPAAEGIYTEGLMHNQDGLICGLRQLANETTQALQLFLRATTELRTFSILNRKAIDFLLQRWGGTCHILGPDCCIEPHDW |
Chain B Sequence |
AIVNAQPKCNPNLHYWTTQDEGAAIGLAWIPYFGPAAEGIYTEGLMHNQDGLICGLRQLANETTQALQLFLRATTELRTFSILNRKAIDFLLQRWGGTCHILGPDCCIEPHDW |
Chain B Sequence |
AIVNAQPKCNPNLHYWTTQDEGAAIGLAWIPYFGPAAEGIYTEGLMHNQDGLICGLRQLANETTQALQLFLRATTELRTFSILNRKAIDFLLQRWGGTCHILGPDCCIEPHDW |
Chain B Sequence |
DIQMTQSPASLSVSVGETVSITCRASENIYSSLAWYQQKQGKSPQLLVYSATILADGVPSRFSGSGSGTQYSLKINSLQSEDFGTYYCQHFWGTPYTFGGGTKLEIK |
| sequence length | 113,113,113,107 |
| structure length | 113,113,113,107 |
| publication title |
Structures of Ebola virus GP and sGP in complex with therapeutic antibodies.
pubmed doi rcsb |
| molecule tags | Viral protein/immune system |
| molecule keywords | Ebola surface glycoprotein, GP1 |
| source organism | Zaire ebolavirus (strain mayinga-76) |
| pdb deposition date | 2016-06-09 |
| LinkProt deposition date | 2016-09-14 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
