| Link type | Probability | Chain B piercings | Chain C piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Unlink | 55% | -56B +90B | |||||||||
| view details |
|
Unlink | 55% | -56B +90B | |||||||||
| view details |
|
Unlink | 55% | -56B +90B | |||||||||
| view details |
|
Unlink | 55% | -56B +90B | |||||||||
| view details |
|
Unlink | 55% | -56B +90B | |||||||||
| view details |
|
Unlink | 55% | -56B +90B | |||||||||
Chain B Sequence |
IQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG |
Chain B Sequence |
RGSRRQIQRLEQLLALYVAEIRRLQEKELDLSELDDPDSAYLQEARLKRKLIRLFGRLCELKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGPDTFPDYGDVLRAVEKAAARHSLGLPRQQLQLMAQDAFRDVGIRLQERRHLDLIYNFGCHLTDDYRPGVDPALSDPVLARRLRENRSLAMSRLDEVISKYAMLQDKS |
| sequence length | 77,205 |
| structure length | 77,205 |
| publication title |
Crystal structure of EBV tegument protein BNRF1 in complex with histone chaperone DAXX and histones H3.3-H4
doi rcsb |
| molecule tags | Chaperone / dna binding protein |
| molecule keywords | Histone H3.3 |
| source organism | Homo sapiens |
| pdb deposition date | 2016-06-08 |
| LinkProt deposition date | 2016-09-14 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
