5K2MJKLN

Bifunctional lysx/argx from thermococcus kodakarensis with lysw-gamma-aaa
L: 23-31 N: 22-29
Link type Probability Chain J piercings Chain K piercings Chain L piercings Chain N piercings
view details
Other Other 33% +53K +53K +54K +50L +70L +273L -42N -274J +53L +8N
view details
Other Other 33% +53K +53K +54K +50L +70L +273L -42N -274J +53L +8N
view details
Other Other 33% +53K +53K +54K +50L +70L +273L -42N -274J +53L +8N
view details
Other Other 33% +53K +53K +54K +50L +70L +273L -42N -274J +53L +8N
view details
Other Other 33% +53K +53K +54K +50L +70L +273L -42N -274J +53L +8N
view details
Other Other 33% +53K +53K +54K +50L +70L +273L -42N -274J +53L +8N
view details
Other Other 33% +53K +53K +54K +50L +70L +273L -42N -274J +53L +8N
view details
Other Other 33% +53K +53K +54K +50L +70L +273L -42N -274J +53L +8N
view details
Other Other 33% +53K +53K +54K +50L +70L +273L -42N -274J +53L +8N
view details
Other Other 33% +53K +53K +54K +50L +70L +273L -42N -274J +53L +8N
view details
Other Other 33% +53K +53K +54K +50L +70L +273L -42N -274J +53L +8N
view details
Other Other 33% +53K +53K +54K +50L +70L +273L -42N -274J +53L +8N
view details
Other Other 33% +53K +53K +54K +50L +70L +273L -42N -274J +53L +8N
view details
Other Other 33% +53K +53K +54K +50L +70L +273L -42N -274J +53L +8N
view details
Other Other 33% +53K +53K +54K +50L +70L +273L -42N -274J +53L +8N
view details
Other Other 33% +53K +53K +54K +50L +70L +273L -42N -274J +53L +8N
view details
Other Other 33% +53K +53K +54K +50L +70L +273L -42N -274J +53L +8N
view details
Other Other 33% +53K +53K +54K +50L +70L +273L -42N -274J +53L +8N
view details
Other Other 33% +53K +53K +54K +50L +70L +273L -42N -274J +53L +8N
view details
Other Other 33% +53K +53K +54K +50L +70L +273L -42N -274J +53L +8N
view details
Other Other 33% +53K +53K +54K +50L +70L +273L -42N -274J +53L +8N
view details
Other Other 33% +53K +53K +54K +50L +70L +273L -42N -274J +53L +8N
view details
Other Other 33% +53K +53K +54K +50L +70L +273L -42N -274J +53L +8N
view details
Other Other 33% +53K +53K +54K +50L +70L +273L -42N -274J +53L +8N
view details
Other Other 33% +53K +53K +54K +50L +70L +273L -42N -274J +53L +8N
view details
Other Other 33% +53K +53K +54K +50L +70L +273L -42N -274J +53L +8N
view details
Other Other 33% +53K +53K +54K +50L +70L +273L -42N -274J +53L +8N
view details
Other Other 33% +53K +53K +54K +50L +70L +273L -42N -274J +53L +8N
view details
Other Other 33% +53K +53K +54K +50L +70L +273L -42N -274J +53L +8N
view details
Other Other 33% +53K +53K +54K +50L +70L +273L -42N -274J +53L +8N
view details
Other Other 33% +53K +53K +54K +50L +70L +273L -42N -274J +53L +8N
view details
Other Other 33% +53K +53K +54K +50L +70L +273L -42N -274J +53L +8N
Interpreting sequences
Chain J Sequence
MRIGITYTVLRREEMAIKERAGEFGEVVMLHEDDLLFPGNYDLDVVIIRNVSHFKALYTARLFESEGIPTVNSSRLIFEAGDKLFATLRLAGKVPVPEWKAALSEGGALRVPDSLGYPLVSKPVFGSWGRLLAKVNDRDSLEAVLEHRKWMKNPLYGIHYFQEFVEKPGRDIRSYVIGGEFVGAIYRYSNHWITNTARGGKAEPCSDPEVEELSVKAWEAFGEGALAIDIFESEKGLLVNEVNPNMEFKNAARVTGADMAGKLVEYAVEVAKT
Chain J Sequence
ELPEVEEDWGE
Chain J Sequence
ELHQIVE-------LEVVSLEPLTLEELPEVEEDWGE
Chain J Sequence
EVELHQIV------AELEVVSLEPLTLEELPEVEEDWGE
sequence length 273,11,37,39
structure length 273,11,30,33
publication title Lysine Biosynthesis of Thermococcus kodakarensis with the Capacity to Function as an Ornithine Biosynthetic System.
pubmed doi rcsb
molecule tags Biosynthetic protein
molecule keywords RimK-related lysine biosynthesis protein
source organism Thermococcus kodakarensis (strain atcc baa-918 / jcm 12380 / kod1)
missing residues L: 23-31 N: 22-29
pdb deposition date2016-05-19
LinkProt deposition date2016-09-14
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling