| Link type | Probability | Chain A piercings | Chain B piercings | Chain C piercings | Chain D piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Other | 30% | -274D | -83A -86A +123A | ||||||||||
| view details |
|
Other | 30% | -274D | -83A -86A +123A | ||||||||||
| view details |
|
Other | 30% | -274D | -83A -86A +123A | ||||||||||
| view details |
|
Other | 30% | -274D | -83A -86A +123A | ||||||||||
| view details |
|
Other | 30% | -274D | -83A -86A +123A | ||||||||||
| view details |
|
Other | 30% | -274D | -83A -86A +123A | ||||||||||
| view details |
|
Other | 30% | -274D | -83A -86A +123A | ||||||||||
| view details |
|
Other | 30% | -274D | -83A -86A +123A | ||||||||||
| view details |
|
Other | 30% | -274D | -83A -86A +123A | ||||||||||
| view details |
|
Other | 30% | -274D | -83A -86A +123A | ||||||||||
| view details |
|
Other | 30% | -274D | -83A -86A +123A | ||||||||||
| view details |
|
Other | 30% | -274D | -83A -86A +123A | ||||||||||
| view details |
|
Other | 30% | -274D | -83A -86A +123A | ||||||||||
| view details |
|
Other | 30% | -274D | -83A -86A +123A | ||||||||||
| view details |
|
Other | 30% | -274D | -83A -86A +123A | ||||||||||
| view details |
|
Other | 30% | -274D | -83A -86A +123A | ||||||||||
| view details |
|
Other | 30% | -274D | -83A -86A +123A | ||||||||||
| view details |
|
Other | 30% | -274D | -83A -86A +123A | ||||||||||
| view details |
|
Other | 30% | -274D | -83A -86A +123A | ||||||||||
| view details |
|
Other | 30% | -274D | -83A -86A +123A | ||||||||||
| view details |
|
Other | 30% | -274D | -83A -86A +123A | ||||||||||
| view details |
|
Other | 30% | -274D | -83A -86A +123A | ||||||||||
| view details |
|
Other | 30% | -274D | -83A -86A +123A | ||||||||||
| view details |
|
Other | 30% | -274D | -83A -86A +123A | ||||||||||
| view details |
|
Other | 30% | -274D | -83A -86A +123A | ||||||||||
| view details |
|
Other | 30% | -274D | -83A -86A +123A | ||||||||||
| view details |
|
Other | 30% | -274D | -83A -86A +123A | ||||||||||
| view details |
|
Other | 30% | -274D | -83A -86A +123A | ||||||||||
| view details |
|
Other | 30% | -274D | -83A -86A +123A | ||||||||||
| view details |
|
Other | 30% | -274D | -83A -86A +123A | ||||||||||
| view details |
|
Other | 30% | -274D | -83A -86A +123A | ||||||||||
| view details |
|
Other | 30% | -274D | -83A -86A +123A | ||||||||||
| view details |
|
Other | 30% | -274D | -83A -86A +123A | ||||||||||
| view details |
|
Other | 30% | -274D | -83A -86A +123A | ||||||||||
| view details |
|
Other | 30% | -274D | -83A -86A +123A | ||||||||||
| view details |
|
Other | 30% | -274D | -83A -86A +123A | ||||||||||
| view details |
|
Other | 30% | -274D | -83A -86A +123A | ||||||||||
Chain A Sequence |
MRIGITYTVLRREEMAIKERAGEFGEVVMLHEDDLLFPGNYDLDVVIIRNVSHFKALYTARLFESEGIPTVNSSRLIFEAGDKLFATLRLAGKVPVPEWKAALSEGGALRVPDSLGYPLVSKPVFGSWGRLLAKVNDRDSLEAVLEHRKWMKNPLYGIHYFQEFVEKPGRDIRSYVIGGEFVGAIYRYSNHWITNTARGGKAEPCSDPEVEELSVKAWEAFGEGALAIDIFESEKGLLVNEVNPNMEFKNAARVTGADMAGKLVEYAVEVAKT |
Chain A Sequence |
MRIGITYTVLRREEMAIKERAGEFGEVVMLHEDDLLFPGNYDLDVVIIRNVSHFKALYTARLFESEGIPTVNSSRLIFEAGDKLFATLRLAGKVPVPEWKAALSEGGALRVPDSLGYPLVSKPVFGSWGRLLAKVNDRDSLEAVLEHRKWMKNPLYGIHYFQEFVEKPGRDIRSYVIGGEFVGAIYRYSNHWITNTARGGKAEPCSDPEVEELSVKAWEAFGEGALAIDIFESEKGLLVNEVNPNMEFKNAARVTGADMAGKLVEYAVEVAKT |
Chain A Sequence |
MRIGITYTVLRREEMAIKERAGEFGEVVMLHEDDLLFPGNYDLDVVIIRNVSHFKALYTARLFESEGIPTVNSSRLIFEAGDKLFATLRLAGKVPVPEWKAALSEGGALRVPDSLGYPLVSKPVFGSWGRLLAKVNDRDSLEAVLEHRKWMKNPLYGIHYFQEFVEKPGRDIRSYVIGGEFVGAIYRYSNHWITNTARGGKAEPCSDPEVEELSVKAWEAFGEGALAIDIFESEKGLLVNEVNPNMEFKNAARVTGADMAGKLVEYAVEVAKT |
Chain A Sequence |
MRIGITYTVLRREEMAIKERAGEFGEVVMLHEDDLLFPGNYDLDVVIIRNVSHFKALYTARLFESEGIPTVNSSRLIFEAGDKLFATLRLAGKVPVPEWKAALSEGGALRVPDSLGYPLVSKPVFGSWGRLLAKVNDRDSLEAVLEHRKWMKNPLYGIHYFQEFVEKPGRDIRSYVIGGEFVGAIYRYSNHWITNT---GKAEPCSDPEVEELSVKAWEAFGEGALAIDIFESEKGLLVNEVNPNMEFKNAARVTGADMAGKLVEYAVEVAKT |
| sequence length | 273,273,273,273 |
| structure length | 273,273,273,270 |
| publication title |
Lysine Biosynthesis of Thermococcus kodakarensis with the Capacity to Function as an Ornithine Biosynthetic System.
pubmed doi rcsb |
| molecule tags | Biosynthetic protein |
| molecule keywords | RimK-related lysine biosynthesis protein |
| source organism | Thermococcus kodakarensis (strain atcc baa-918 / jcm 12380 / kod1) |
| missing residues | D: 196-200 |
| pdb deposition date | 2016-05-19 |
| LinkProt deposition date | 2016-09-14 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
