| Link type | Probability | Chain G piercings | Chain H piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
|
Unlink | 48% | -115H +125H | |||||||||
| view details |
|
Unlink | 48% | -115H +125H | |||||||||
| view details |
|
Unlink | 48% | -115H +125H | |||||||||
| view details |
|
Unlink | 48% | -115H +125H | |||||||||
| view details |
|
Unlink | 48% | -115H +125H | |||||||||
| view details |
|
Unlink | 48% | -115H +125H | |||||||||
| view details |
|
Unlink | 48% | -115H +125H | |||||||||
Chain G Sequence |
ARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK |
Chain G Sequence |
RKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA |
| sequence length | 109,96 |
| structure length | 109,96 |
| publication title |
Polymorphism of apyrimidinic DNA structures in the nucleosome
pubmed doi rcsb |
| molecule tags | Dna binding protein/dna |
| molecule keywords | Histone H3.1 |
| source organism | Homo sapiens |
| pdb deposition date | 2016-05-06 |
| LinkProt deposition date | 2017-03-11 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...