Link type | Probability | Chain B piercings | Chain G piercings | Chain H piercings | ||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
Hopf.2 U Ring | 35% | -123B -52G | ||||||||||
view details |
![]() |
Hopf.2 U Ring | 35% | -123B -52G | ||||||||||
view details |
![]() |
Hopf.2 U Ring | 35% | -123B -52G | ||||||||||
view details |
![]() |
Hopf.2 U Ring | 35% | -123B -52G | ||||||||||
view details |
![]() |
Hopf.2 U Ring | 35% | -123B -52G | ||||||||||
view details |
![]() |
Hopf.2 U Ring | 35% | -123B -52G | ||||||||||
view details |
![]() |
Hopf.2 U Ring | 35% | -123B -52G | ||||||||||
view details |
![]() |
Hopf.2 U Ring | 35% | -123B -52G | ||||||||||
view details |
![]() |
Hopf.2 U Ring | 35% | -123B -52G | ||||||||||
view details |
![]() |
Hopf.2 U Ring | 35% | -123B -52G | ||||||||||
view details |
![]() |
Hopf.2 U Ring | 35% | -123B -52G | ||||||||||
view details |
![]() |
Hopf.2 U Ring | 35% | -123B -52G | ||||||||||
view details |
![]() |
Hopf.2 U Ring | 35% | -123B -52G | ||||||||||
view details |
![]() |
Hopf.2 U Ring | 35% | -123B -52G | ||||||||||
view details |
![]() |
Hopf.2 U Ring | 35% | -123B -52G | ||||||||||
view details |
![]() |
Hopf.2 U Ring | 35% | -123B -52G | ||||||||||
view details |
![]() |
Hopf.2 U Ring | 35% | -123B -52G |
Chain B Sequence |
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG |
Chain B Sequence |
ARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK |
Chain B Sequence |
RKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA |
sequence length | 78,109,96 |
structure length | 78,109,96 |
publication title |
Polymorphism of apyrimidinic DNA structures in the nucleosome
pubmed doi rcsb |
molecule tags | Dna binding protein/dna |
molecule keywords | Histone H3.1 |
source organism | Homo sapiens |
pdb deposition date | 2016-05-06 |
LinkProt deposition date | 2017-03-11 |
#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...