5JRGBCFG

Crystal structure of the nucleosome containing the dna with tetrahydrofuran (thf)
Link type Probability Chain B piercings Chain C piercings Chain F piercings Chain G piercings
view details
Other Other 60% +68C +102F -118F -102G -118G
view details
Other Other 60% +68C +102F -118F -102G -118G
view details
Other Other 60% +68C +102F -118F -102G -118G
view details
Other Other 60% +68C +102F -118F -102G -118G
view details
Other Other 60% +68C +102F -118F -102G -118G
view details
Other Other 60% +68C +102F -118F -102G -118G
view details
Other Other 60% +68C +102F -118F -102G -118G
view details
Other Other 60% +68C +102F -118F -102G -118G
view details
Other Other 60% +68C +102F -118F -102G -118G
view details
Other Other 60% +68C +102F -118F -102G -118G
view details
Other Other 60% +68C +102F -118F -102G -118G
view details
Other Other 60% +68C +102F -118F -102G -118G
view details
Other Other 60% +68C +102F -118F -102G -118G
view details
Other Other 60% +68C +102F -118F -102G -118G
view details
Other Other 60% +68C +102F -118F -102G -118G
view details
Other Other 60% +68C +102F -118F -102G -118G
view details
Other Other 60% +68C +102F -118F -102G -118G
view details
Other Other 60% +68C +102F -118F -102G -118G
view details
Other Other 60% +68C +102F -118F -102G -118G
view details
Other Other 60% +68C +102F -118F -102G -118G
Interpreting sequences
Chain B Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Chain B Sequence
AKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Chain B Sequence
RHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Chain B Sequence
ARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
sequence length 78,107,86,109
structure length 78,107,86,109
publication title Polymorphism of apyrimidinic DNA structures in the nucleosome
pubmed doi rcsb
molecule tags Dna binding protein/dna
molecule keywords Histone H3.1
source organism Homo sapiens
pdb deposition date2016-05-06
LinkProt deposition date2017-03-11
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling