5JRGABGH

Crystal structure of the nucleosome containing the dna with tetrahydrofuran (thf)
Link type Probability Chain A piercings Chain B piercings Chain G piercings Chain H piercings
view details
Other Other 32% -81B +102B +68G -135G
view details
Other Other 32% -81B +102B +68G -135G
view details
Other Other 32% -81B +102B +68G -135G
view details
Other Other 32% -81B +102B +68G -135G
view details
Other Other 32% -81B +102B +68G -135G
view details
Other Other 32% -81B +102B +68G -135G
view details
Other Other 32% -81B +102B +68G -135G
view details
Other Other 32% -81B +102B +68G -135G
view details
Other Other 32% -81B +102B +68G -135G
view details
Other Other 32% -81B +102B +68G -135G
view details
Other Other 32% -81B +102B +68G -135G
view details
Other Other 32% -81B +102B +68G -135G
view details
Other Other 32% -81B +102B +68G -135G
view details
Other Other 32% -81B +102B +68G -135G
view details
Other Other 32% -81B +102B +68G -135G
view details
Other Other 32% -81B +102B +68G -135G
view details
Other Other 32% -81B +102B +68G -135G
view details
Other Other 32% -81B +102B +68G -135G
view details
Other Other 32% -81B +102B +68G -135G
view details
Other Other 32% -81B +102B +68G -135G
view details
Other Other 32% -81B +102B +68G -135G
view details
Other Other 32% -81B +102B +68G -135G
view details
Other Other 32% -81B +102B +68G -135G
Interpreting sequences
Chain A Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Chain A Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Chain A Sequence
ARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Chain A Sequence
RKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
sequence length 97,78,109,96
structure length 97,78,109,96
publication title Polymorphism of apyrimidinic DNA structures in the nucleosome
pubmed doi rcsb
molecule tags Dna binding protein/dna
molecule keywords Histone H3.1
source organism Homo sapiens
pdb deposition date2016-05-06
LinkProt deposition date2017-03-11
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling