5JIBABCF

Crystal structure of the thermotoga maritima acetyl esterase (tm0077) complex with a substrate analog
A: 133-135 B: 133-135
Link type Probability Chain A piercings Chain B piercings Chain C piercings Chain F piercings
view details
Other Other 31% -79B +273B -323F -323F -324F -4A -255A -279A -323A -324B
view details
Other Other 31% -79B +273B -323F -323F -324F -4A -255A -279A -323A -324B
view details
Other Other 31% -79B +273B -323F -323F -324F -4A -255A -279A -323A -324B
view details
Other Other 31% -79B +273B -323F -323F -324F -4A -255A -279A -323A -324B
view details
Other Other 31% -79B +273B -323F -323F -324F -4A -255A -279A -323A -324B
view details
Other Other 31% -79B +273B -323F -323F -324F -4A -255A -279A -323A -324B
view details
Other Other 31% -79B +273B -323F -323F -324F -4A -255A -279A -323A -324B
view details
Other Other 31% -79B +273B -323F -323F -324F -4A -255A -279A -323A -324B
view details
Other Other 31% -79B +273B -323F -323F -324F -4A -255A -279A -323A -324B
view details
Other Other 31% -79B +273B -323F -323F -324F -4A -255A -279A -323A -324B
view details
Other Other 31% -79B +273B -323F -323F -324F -4A -255A -279A -323A -324B
view details
Other Other 31% -79B +273B -323F -323F -324F -4A -255A -279A -323A -324B
view details
Other Other 31% -79B +273B -323F -323F -324F -4A -255A -279A -323A -324B
view details
Other Other 31% -79B +273B -323F -323F -324F -4A -255A -279A -323A -324B
view details
Other Other 31% -79B +273B -323F -323F -324F -4A -255A -279A -323A -324B
view details
Other Other 31% -79B +273B -323F -323F -324F -4A -255A -279A -323A -324B
view details
Other Other 31% -79B +273B -323F -323F -324F -4A -255A -279A -323A -324B
view details
Other Other 31% -79B +273B -323F -323F -324F -4A -255A -279A -323A -324B
view details
Other Other 31% -79B +273B -323F -323F -324F -4A -255A -279A -323A -324B
view details
Other Other 31% -79B +273B -323F -323F -324F -4A -255A -279A -323A -324B
view details
Other Other 31% -79B +273B -323F -323F -324F -4A -255A -279A -323A -324B
view details
Other Other 31% -79B +273B -323F -323F -324F -4A -255A -279A -323A -324B
view details
Other Other 31% -79B +273B -323F -323F -324F -4A -255A -279A -323A -324B
view details
Other Other 31% -79B +273B -323F -323F -324F -4A -255A -279A -323A -324B
view details
Other Other 31% -79B +273B -323F -323F -324F -4A -255A -279A -323A -324B
view details
Other Other 31% -79B +273B -323F -323F -324F -4A -255A -279A -323A -324B
view details
Other Other 31% -79B +273B -323F -323F -324F -4A -255A -279A -323A -324B
view details
Other Other 31% -79B +273B -323F -323F -324F -4A -255A -279A -323A -324B
view details
Other Other 31% -79B +273B -323F -323F -324F -4A -255A -279A -323A -324B
view details
Other Other 31% -79B +273B -323F -323F -324F -4A -255A -279A -323A -324B
view details
Other Other 31% -79B +273B -323F -323F -324F -4A -255A -279A -323A -324B
view details
Other Other 31% -79B +273B -323F -323F -324F -4A -255A -279A -323A -324B
view details
Other Other 31% -79B +273B -323F -323F -324F -4A -255A -279A -323A -324B
view details
Other Other 31% -79B +273B -323F -323F -324F -4A -255A -279A -323A -324B
view details
Other Other 31% -79B +273B -323F -323F -324F -4A -255A -279A -323A -324B
view details
Other Other 31% -79B +273B -323F -323F -324F -4A -255A -279A -323A -324B
view details
Other Other 31% -79B +273B -323F -323F -324F -4A -255A -279A -323A -324B
view details
Other Other 31% -79B +273B -323F -323F -324F -4A -255A -279A -323A -324B
view details
Other Other 31% -79B +273B -323F -323F -324F -4A -255A -279A -323A -324B
view details
Other Other 31% -79B +273B -323F -323F -324F -4A -255A -279A -323A -324B
view details
Other Other 31% -79B +273B -323F -323F -324F -4A -255A -279A -323A -324B
view details
Other Other 31% -79B +273B -323F -323F -324F -4A -255A -279A -323A -324B
view details
Other Other 31% -79B +273B -323F -323F -324F -4A -255A -279A -323A -324B
view details
Other Other 31% -79B +273B -323F -323F -324F -4A -255A -279A -323A -324B
view details
Other Other 31% -79B +273B -323F -323F -324F -4A -255A -279A -323A -324B
view details
Other Other 31% -79B +273B -323F -323F -324F -4A -255A -279A -323A -324B
view details
Other Other 31% -79B +273B -323F -323F -324F -4A -255A -279A -323A -324B
view details
Other Other 31% -79B +273B -323F -323F -324F -4A -255A -279A -323A -324B
view details
Other Other 31% -79B +273B -323F -323F -324F -4A -255A -279A -323A -324B
view details
Other Other 31% -79B +273B -323F -323F -324F -4A -255A -279A -323A -324B
Interpreting sequences
Chain A Sequence
FDLPLEELKKYRPERYEEKDFDEFWEETLAESEKFPLDPVFERMESHLKTVEAYDVTFSGYRGQRIKGWLLVPKLEEEKLPCVVQYIGYNGGRGFPHDWLFWPSMGYICFVMDTRGQGSGWLKGDTPDYP-GPVDPQYPGFMTRGILDPRTYYYRRVFTDAVRAVEAAASFPQVDQERIVIAGGSQGGGIALAVSALSKKAKALLCDVPFLCHFRRAVQLVDTHPYAEITNFLKTHRDKEEIVFRTLSYFDGVNFAARAKIPALFSVGLMDNICPPSTVFAAYNYYAGPKEIRIYPYNNHEGGGSFQAVEQVKFLKKLFE
Chain A Sequence
FDLPLEELKKYRPERYEEKDFDEFWEETLAESEKFPLDPVFERMESHLKTVEAYDVTFSGYRGQRIKGWLLVPKLEEEKLPCVVQYIGYNGGRGFPHDWLFWPSMGYICFVMDTRGQGSGWLKGDTPDYP-GPVDPQYPGFMTRGILDPRTYYYRRVFTDAVRAVEAAASFPQVDQERIVIAGGSQGGGIALAVSALSKKAKALLCDVPFLCHFRRAVQLVDTHPYAEITNFLKTHRDKEEIVFRTLSYFDGVNFAARAKIPALFSVGLMDNICPPSTVFAAYNYYAGPKEIRIYPYNNHEGGGSFQAVEQVKFLKKLFE
Chain A Sequence
FDLPLEELKKYRPERYEEKDFDEFWEETLAESEKFPLDPVFERMESHLKTVEAYDVTFSGYRGQRIKGWLLVPKLEEEKLPCVVQYIGYNGGRGFPHDWLFWPSMGYICFVMDTRGQGSGWLKGDTPDYPEGPVDPQYPGFMTRGILDPRTYYYRRVFTDAVRAVEAAASFPQVDQERIVIAGGSQGGGIALAVSALSKKAKALLCDVPFLCHFRRAVQLVDTHPYAEITNFLKTHRDKEEIVFRTLSYFDGVNFAARAKIPALFSVGLMDNICPPSTVFAAYNYYAGPKEIRIYPYNNHEGGGSFQAVEQVKFLKKLFE
Chain A Sequence
FDLPLEELKKYRPERYEEKDFDEFWEETLAESEKFPLDPVFERMESHLKTVEAYDVTFSGYRGQRIKGWLLVPKLEEEKLPCVVQYIGYNGGRGFPHDWLFWPSMGYICFVMDTRGQGSGWLKGDTPDYPEGPVDPQYPGFMTRGILDPRTYYYRRVFTDAVRAVEAAASFPQVDQERIVIAGGSQGGGIALAVSALSKKAKALLCDVPFLCHFRRAVQLVDTHPYAEITNFLKTHRDKEEIVFRTLSYFDGVNFAARAKIPALFSVGLMDNICPPSTVFAAYNYYAGPKEIRIYPYNNHEGGGSFQAVEQVKFLKKLFE
sequence length 320,320,320,320
structure length 319,319,320,320
publication title Crystal structure of Thermotoga maritima acetyl esterase complex with a substrate analog: Insights into the distinctive substrate specificity in the CE7 carbohydrate esterase family
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Cephalosporin-C deacetylase
source organism Thermotoga maritima (strain atcc 43589 / msb8 / dsm 3109 / jcm 10099)
missing residues A: 133-135 B: 133-135
pdb deposition date2016-04-22
LinkProt deposition date2017-03-09
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling