| Link type | Probability | Chain A piercings | Chain B piercings | Chain D piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Hopf.2 U Ring | 35% | -91B -102D | -7A +26A -52A +64A | |||||||||
| view details |
|
Hopf.2 U Ring | 35% | -91B -102D | -7A +26A -52A +64A | |||||||||
| view details |
|
Hopf.2 U Ring | 35% | -91B -102D | -7A +26A -52A +64A | |||||||||
| view details |
|
Hopf.2 U Ring | 35% | -91B -102D | -7A +26A -52A +64A | |||||||||
| view details |
|
Hopf.2 U Ring | 35% | -91B -102D | -7A +26A -52A +64A | |||||||||
| view details |
|
Hopf.2 U Ring | 35% | -91B -102D | -7A +26A -52A +64A | |||||||||
| view details |
|
Hopf.2 U Ring | 35% | -91B -102D | -7A +26A -52A +64A | |||||||||
| view details |
|
Hopf.2 U Ring | 35% | -91B -102D | -7A +26A -52A +64A | |||||||||
| view details |
|
Hopf.2 U Ring | 35% | -91B -102D | -7A +26A -52A +64A | |||||||||
| view details |
|
Hopf.2 U Ring | 35% | -91B -102D | -7A +26A -52A +64A | |||||||||
| view details |
|
Hopf.2 U Ring | 35% | -91B -102D | -7A +26A -52A +64A | |||||||||
| view details |
|
Hopf.2 U Ring | 35% | -91B -102D | -7A +26A -52A +64A | |||||||||
| view details |
|
Hopf.2 U Ring | 35% | -91B -102D | -7A +26A -52A +64A | |||||||||
| view details |
|
Hopf.2 U Ring | 35% | -91B -102D | -7A +26A -52A +64A | |||||||||
| view details |
|
Hopf.2 U Ring | 35% | -91B -102D | -7A +26A -52A +64A | |||||||||
| view details |
|
Hopf.2 U Ring | 35% | -91B -102D | -7A +26A -52A +64A | |||||||||
| view details |
|
Hopf.2 U Ring | 35% | -91B -102D | -7A +26A -52A +64A | |||||||||
| view details |
|
Hopf.2 U Ring | 35% | -91B -102D | -7A +26A -52A +64A | |||||||||
| view details |
|
Hopf.2 U Ring | 35% | -91B -102D | -7A +26A -52A +64A | |||||||||
| view details |
|
Hopf.2 U Ring | 35% | -91B -102D | -7A +26A -52A +64A | |||||||||
| view details |
|
Hopf.2 U Ring | 35% | -91B -102D | -7A +26A -52A +64A | |||||||||
Chain A Sequence |
NRDLFAELSSALVEAKQHSEGKLTLKTHHVNDVGELNISPDEIVSIREQFNMSRGVFARLLHTSSRTLENWEQGRSVPNGQAVTLLKLVQRHPETLSHIAEL |
Chain A Sequence |
RDLFAELSSALVEAKQHSEGKLTLKTHHVNDVGELNISPDEIVSIREQFNMSRGVFARLLHTSSRTLENWEQGRSVPNGQAVTLLKLVQRHPETLSHIAEL |
Chain A Sequence |
KSVFVESTIFEKYRDEYLSDEEYRLFQAELMLNPKLGDVIQGTGGLRKIRVAS------GGSRIIYYFLDEKRRFYLLTIYGKNEMSDLNANQRKQLMAFMEAWRNEQ |
| sequence length | 102,101,108 |
| structure length | 102,101,102 |
| publication title |
Ribosome-dependent Vibrio cholerae mRNAse HigB2 is regulated by a beta-strand sliding mechanism.
pubmed doi rcsb |
| molecule tags | Toxin |
| molecule keywords | Antitoxin igA-2 |
| source organism | Vibrio cholerae serotype o1 (strain atcc 39315 / el tor inaba n16961) |
| missing residues | D: 54-61 |
| pdb deposition date | 2016-04-12 |
| LinkProt deposition date | 2017-04-09 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
