5JA8ABCD

Crystal structure of the higb2 toxin in complex with nb2
A: 54-60 C: 55-59
Link type Probability Chain A piercings Chain B piercings Chain C piercings Chain D piercings
view details
Other Other 33% -123B -95C -9D -102D -109A -110A -129C -109D
view details
Other Other 33% -123B -95C -9D -102D -109A -110A -129C -109D
view details
Other Other 33% -123B -95C -9D -102D -109A -110A -129C -109D
view details
Other Other 33% -123B -95C -9D -102D -109A -110A -129C -109D
view details
Other Other 33% -123B -95C -9D -102D -109A -110A -129C -109D
view details
Other Other 33% -123B -95C -9D -102D -109A -110A -129C -109D
view details
Other Other 33% -123B -95C -9D -102D -109A -110A -129C -109D
view details
Other Other 33% -123B -95C -9D -102D -109A -110A -129C -109D
view details
Other Other 33% -123B -95C -9D -102D -109A -110A -129C -109D
view details
Other Other 33% -123B -95C -9D -102D -109A -110A -129C -109D
view details
Other Other 33% -123B -95C -9D -102D -109A -110A -129C -109D
view details
Other Other 33% -123B -95C -9D -102D -109A -110A -129C -109D
view details
Other Other 33% -123B -95C -9D -102D -109A -110A -129C -109D
view details
Other Other 33% -123B -95C -9D -102D -109A -110A -129C -109D
view details
Other Other 33% -123B -95C -9D -102D -109A -110A -129C -109D
view details
Other Other 33% -123B -95C -9D -102D -109A -110A -129C -109D
view details
Other Other 33% -123B -95C -9D -102D -109A -110A -129C -109D
view details
Other Other 33% -123B -95C -9D -102D -109A -110A -129C -109D
view details
Other Other 33% -123B -95C -9D -102D -109A -110A -129C -109D
view details
Other Other 33% -123B -95C -9D -102D -109A -110A -129C -109D
view details
Other Other 33% -123B -95C -9D -102D -109A -110A -129C -109D
view details
Other Other 33% -123B -95C -9D -102D -109A -110A -129C -109D
view details
Other Other 33% -123B -95C -9D -102D -109A -110A -129C -109D
view details
Other Other 33% -123B -95C -9D -102D -109A -110A -129C -109D
view details
Other Other 33% -123B -95C -9D -102D -109A -110A -129C -109D
view details
Other Other 33% -123B -95C -9D -102D -109A -110A -129C -109D
view details
Other Other 33% -123B -95C -9D -102D -109A -110A -129C -109D
view details
Other Other 33% -123B -95C -9D -102D -109A -110A -129C -109D
view details
Other Other 33% -123B -95C -9D -102D -109A -110A -129C -109D
view details
Other Other 33% -123B -95C -9D -102D -109A -110A -129C -109D
view details
Other Other 33% -123B -95C -9D -102D -109A -110A -129C -109D
view details
Other Other 33% -123B -95C -9D -102D -109A -110A -129C -109D
view details
Other Other 33% -123B -95C -9D -102D -109A -110A -129C -109D
view details
Other Other 33% -123B -95C -9D -102D -109A -110A -129C -109D
view details
Other Other 33% -123B -95C -9D -102D -109A -110A -129C -109D
view details
Other Other 33% -123B -95C -9D -102D -109A -110A -129C -109D
view details
Other Other 33% -123B -95C -9D -102D -109A -110A -129C -109D
view details
Other Other 33% -123B -95C -9D -102D -109A -110A -129C -109D
Interpreting sequences
Chain A Sequence
HMKSVFVESTIFEKYRDEYLSDEEYRLFQAELMLNPKLGDVIQGTGGLRKIRVAS-----RGGSRIIYYFLDEKRRFYLLTIYGKNEMSDLNANQRKQLMAFMEAWRNEQ
Chain A Sequence
QVQLQESGGGLVQPGGSLRLSCAASGFTLDYYAIGWFRQAPGKEREGVSCISSSGGTTNYADSVKGRFTVSRDNAKNTVYLQMNSLKPEDTAVYYCVADFACPLIREYDYWGQGTQVTVSS
Chain A Sequence
HMKSVFVESTIFEKYRDEYLSDEEYRLFQAELMLNPKLGDVIQGTGGLRKIRVASK---KRGGSRIIYYFLDEKRRFYLLTIYGKNEMSDLNANQRKQLMAFMEAWRNEQS
Chain A Sequence
QVQLQESGGGLVQPGGSLRLSCAASGFTLDYYAIGWFRQAPGKEREGVSCISSSGGTTNYADSVKGRFTVSRDNAKNTVYLQMNSLKPEDTAVYYCVADFACPLIREYDYWGQGTQVTVSSHHHHHH
sequence length 110,121,111,127
structure length 105,121,108,127
publication title Ribosome-dependent Vibrio cholerae mRNAse HigB2 is regulated by a beta-strand sliding mechanism.
pubmed doi rcsb
molecule tags Toxin
molecule keywords Toxin HigB-2
source organism Vibrio cholerae serotype o1 (strain atcc 39315 / el tor inaba n16961)
missing residues A: 54-60 C: 55-59
pdb deposition date2016-04-12
LinkProt deposition date2017-04-09
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling