5J9IABCD

Crystal structure of the higa2 antitoxin c-terminal domain
Link type Probability Chain A piercings Chain B piercings Chain C piercings Chain D piercings
view details
Other Other 43% +104B +105C -105D -80A +104A +104B
view details
Other Other 43% +104B +105C -105D -80A +104A +104B
view details
Other Other 43% +104B +105C -105D -80A +104A +104B
view details
Other Other 43% +104B +105C -105D -80A +104A +104B
view details
Other Other 43% +104B +105C -105D -80A +104A +104B
view details
Other Other 43% +104B +105C -105D -80A +104A +104B
view details
Other Other 43% +104B +105C -105D -80A +104A +104B
view details
Other Other 43% +104B +105C -105D -80A +104A +104B
view details
Other Other 43% +104B +105C -105D -80A +104A +104B
view details
Other Other 43% +104B +105C -105D -80A +104A +104B
view details
Other Other 43% +104B +105C -105D -80A +104A +104B
view details
Other Other 43% +104B +105C -105D -80A +104A +104B
view details
Other Other 43% +104B +105C -105D -80A +104A +104B
view details
Other Other 43% +104B +105C -105D -80A +104A +104B
view details
Other Other 43% +104B +105C -105D -80A +104A +104B
view details
Other Other 43% +104B +105C -105D -80A +104A +104B
view details
Other Other 43% +104B +105C -105D -80A +104A +104B
view details
Other Other 43% +104B +105C -105D -80A +104A +104B
view details
Other Other 43% +104B +105C -105D -80A +104A +104B
view details
Other Other 43% +104B +105C -105D -80A +104A +104B
view details
Other Other 43% +104B +105C -105D -80A +104A +104B
view details
Other Other 43% +104B +105C -105D -80A +104A +104B
Interpreting sequences
Chain A Sequence
LNISPDEIVSIREQFNMSRGVFARLLHTSSRTLENWEQGRSVPNGQAVTLLKLVQRHPETLSHIAEL
Chain A Sequence
ELNISPDEIVSIREQFNMSRGVFARLLHTSSRTLENWEQGRSVPNGQAVTLLKLVQRHPETLSHIAEL
Chain A Sequence
GELNISPDEIVSIREQFNMSRGVFARLLHTSSRTLENWEQGRSVPNGQAVTLLKLVQRHPETLSHIAEL
Chain A Sequence
ELNISPDEIVSIREQFNMSRGVFARLLHTSSRTLENWEQGRSVPNGQAVTLLKLVQRHPETLSHIAEL
sequence length 67,68,69,68
structure length 67,68,69,68
publication title Ribosome-dependent Vibrio cholerae mRNAse HigB2 is regulated by a beta-strand sliding mechanism.
pubmed doi rcsb
molecule tags Antitoxin
molecule keywords Antitoxin igA-2
source organism Vibrio cholerae
pdb deposition date2016-04-10
LinkProt deposition date2017-04-09
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling