5IY5NOPY

Electron transfer complex of cytochrome c and cytochrome c oxidase at 2.0 angstrom resolution
Link type Probability Chain N piercings Chain O piercings Chain P piercings Chain Y piercings
view details
Other Other 30% -28O +65O -261Y -261Y -167N +182N -264N -506N -48P -198Y +231Y -515Y -261N -51O
view details
Other Other 30% -28O +65O -261Y -261Y -167N +182N -264N -506N -48P -198Y +231Y -515Y -261N -51O
view details
Other Other 30% -28O +65O -261Y -261Y -167N +182N -264N -506N -48P -198Y +231Y -515Y -261N -51O
view details
Other Other 30% -28O +65O -261Y -261Y -167N +182N -264N -506N -48P -198Y +231Y -515Y -261N -51O
view details
Other Other 30% -28O +65O -261Y -261Y -167N +182N -264N -506N -48P -198Y +231Y -515Y -261N -51O
view details
Other Other 30% -28O +65O -261Y -261Y -167N +182N -264N -506N -48P -198Y +231Y -515Y -261N -51O
view details
Other Other 30% -28O +65O -261Y -261Y -167N +182N -264N -506N -48P -198Y +231Y -515Y -261N -51O
view details
Other Other 30% -28O +65O -261Y -261Y -167N +182N -264N -506N -48P -198Y +231Y -515Y -261N -51O
view details
Other Other 30% -28O +65O -261Y -261Y -167N +182N -264N -506N -48P -198Y +231Y -515Y -261N -51O
view details
Other Other 30% -28O +65O -261Y -261Y -167N +182N -264N -506N -48P -198Y +231Y -515Y -261N -51O
view details
Other Other 30% -28O +65O -261Y -261Y -167N +182N -264N -506N -48P -198Y +231Y -515Y -261N -51O
view details
Other Other 30% -28O +65O -261Y -261Y -167N +182N -264N -506N -48P -198Y +231Y -515Y -261N -51O
view details
Other Other 30% -28O +65O -261Y -261Y -167N +182N -264N -506N -48P -198Y +231Y -515Y -261N -51O
view details
Other Other 30% -28O +65O -261Y -261Y -167N +182N -264N -506N -48P -198Y +231Y -515Y -261N -51O
view details
Other Other 30% -28O +65O -261Y -261Y -167N +182N -264N -506N -48P -198Y +231Y -515Y -261N -51O
view details
Other Other 30% -28O +65O -261Y -261Y -167N +182N -264N -506N -48P -198Y +231Y -515Y -261N -51O
view details
Other Other 30% -28O +65O -261Y -261Y -167N +182N -264N -506N -48P -198Y +231Y -515Y -261N -51O
view details
Other Other 30% -28O +65O -261Y -261Y -167N +182N -264N -506N -48P -198Y +231Y -515Y -261N -51O
view details
Other Other 30% -28O +65O -261Y -261Y -167N +182N -264N -506N -48P -198Y +231Y -515Y -261N -51O
view details
Other Other 30% -28O +65O -261Y -261Y -167N +182N -264N -506N -48P -198Y +231Y -515Y -261N -51O
view details
Other Other 30% -28O +65O -261Y -261Y -167N +182N -264N -506N -48P -198Y +231Y -515Y -261N -51O
view details
Other Other 30% -28O +65O -261Y -261Y -167N +182N -264N -506N -48P -198Y +231Y -515Y -261N -51O
view details
Other Other 30% -28O +65O -261Y -261Y -167N +182N -264N -506N -48P -198Y +231Y -515Y -261N -51O
view details
Other Other 30% -28O +65O -261Y -261Y -167N +182N -264N -506N -48P -198Y +231Y -515Y -261N -51O
view details
Other Other 30% -28O +65O -261Y -261Y -167N +182N -264N -506N -48P -198Y +231Y -515Y -261N -51O
view details
Other Other 30% -28O +65O -261Y -261Y -167N +182N -264N -506N -48P -198Y +231Y -515Y -261N -51O
view details
Other Other 30% -28O +65O -261Y -261Y -167N +182N -264N -506N -48P -198Y +231Y -515Y -261N -51O
view details
Other Other 30% -28O +65O -261Y -261Y -167N +182N -264N -506N -48P -198Y +231Y -515Y -261N -51O
view details
Other Other 30% -28O +65O -261Y -261Y -167N +182N -264N -506N -48P -198Y +231Y -515Y -261N -51O
view details
Other Other 30% -28O +65O -261Y -261Y -167N +182N -264N -506N -48P -198Y +231Y -515Y -261N -51O
view details
Other Other 30% -28O +65O -261Y -261Y -167N +182N -264N -506N -48P -198Y +231Y -515Y -261N -51O
view details
Other Other 30% -28O +65O -261Y -261Y -167N +182N -264N -506N -48P -198Y +231Y -515Y -261N -51O
view details
Other Other 30% -28O +65O -261Y -261Y -167N +182N -264N -506N -48P -198Y +231Y -515Y -261N -51O
view details
Other Other 30% -28O +65O -261Y -261Y -167N +182N -264N -506N -48P -198Y +231Y -515Y -261N -51O
view details
Other Other 30% -28O +65O -261Y -261Y -167N +182N -264N -506N -48P -198Y +231Y -515Y -261N -51O
view details
Other Other 30% -28O +65O -261Y -261Y -167N +182N -264N -506N -48P -198Y +231Y -515Y -261N -51O
view details
Other Other 30% -28O +65O -261Y -261Y -167N +182N -264N -506N -48P -198Y +231Y -515Y -261N -51O
view details
Other Other 30% -28O +65O -261Y -261Y -167N +182N -264N -506N -48P -198Y +231Y -515Y -261N -51O
view details
Other Other 30% -28O +65O -261Y -261Y -167N +182N -264N -506N -48P -198Y +231Y -515Y -261N -51O
view details
Other Other 30% -28O +65O -261Y -261Y -167N +182N -264N -506N -48P -198Y +231Y -515Y -261N -51O
view details
Other Other 30% -28O +65O -261Y -261Y -167N +182N -264N -506N -48P -198Y +231Y -515Y -261N -51O
view details
Other Other 30% -28O +65O -261Y -261Y -167N +182N -264N -506N -48P -198Y +231Y -515Y -261N -51O
view details
Other Other 30% -28O +65O -261Y -261Y -167N +182N -264N -506N -48P -198Y +231Y -515Y -261N -51O
view details
Other Other 30% -28O +65O -261Y -261Y -167N +182N -264N -506N -48P -198Y +231Y -515Y -261N -51O
view details
Other Other 30% -28O +65O -261Y -261Y -167N +182N -264N -506N -48P -198Y +231Y -515Y -261N -51O
view details
Other Other 30% -28O +65O -261Y -261Y -167N +182N -264N -506N -48P -198Y +231Y -515Y -261N -51O
view details
Other Other 30% -28O +65O -261Y -261Y -167N +182N -264N -506N -48P -198Y +231Y -515Y -261N -51O
view details
Other Other 30% -28O +65O -261Y -261Y -167N +182N -264N -506N -48P -198Y +231Y -515Y -261N -51O
view details
Other Other 30% -28O +65O -261Y -261Y -167N +182N -264N -506N -48P -198Y +231Y -515Y -261N -51O
view details
Other Other 30% -28O +65O -261Y -261Y -167N +182N -264N -506N -48P -198Y +231Y -515Y -261N -51O
view details
Other Other 30% -28O +65O -261Y -261Y -167N +182N -264N -506N -48P -198Y +231Y -515Y -261N -51O
view details
Other Other 30% -28O +65O -261Y -261Y -167N +182N -264N -506N -48P -198Y +231Y -515Y -261N -51O
view details
Other Other 30% -28O +65O -261Y -261Y -167N +182N -264N -506N -48P -198Y +231Y -515Y -261N -51O
Interpreting sequences
Chain N Sequence
FINRWLFSTNHKDIGTLYLLFGAWAGMVGTALSLLIRAELGQPGTLLGDDQIYNVVVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSMVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGVSSILGAINFITTIINMKPPAMSQYQTPLFVWSVMITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKVFSWLATLHGGNIKWSPAMMWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWFPLFSGYTLNDTWAKIHFAIMFVGVNMTFFPQHFLGLSGMPRRYSDYPDAYTMWNTISSMGSFISLTAVMLMVFIIWEAFASKREVLTVDLTTTNLEWLNGCPPPYHTFEEPTYVNLK
Chain N Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Chain N Sequence
HQTHAYHMVNPSPWPLTGALSALLMTSGLTMWFHFNSMTLLMIGLTTNMLTMYQWWRDVIRESTFQGHHTPAVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPLEVPLLNTSVLLASGVSITWAHHSLMEGDRKHMLQALFITITLGVYFTLLQASEYYEAPFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHFVDVVWLFLYVSIYWWGS
Chain N Sequence
HYEEGPGKNIPFSVENKWRLLAMMTLFFGSGFAAPFFIVRHQLLKK
sequence length 513,226,259,46
structure length 513,226,259,46
publication title Complex structure of cytochrome c-cytochrome c oxidase reveals a novel protein-protein interaction mode
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
pdb deposition date2016-03-24
LinkProt deposition date2017-01-14
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling