5IY5GPTY

Electron transfer complex of cytochrome c and cytochrome c oxidase at 2.0 angstrom resolution
Link type Probability Chain G piercings Chain P piercings Chain T piercings Chain Y piercings
view details
Other Other 32% +125P -176P +207P -254P -262P -50T +85Y +84G +85G +38P +139P -183P +205P -247P
view details
Other Other 32% +125P -176P +207P -254P -262P -50T +85Y +84G +85G +38P +139P -183P +205P -247P
view details
Other Other 32% +125P -176P +207P -254P -262P -50T +85Y +84G +85G +38P +139P -183P +205P -247P
view details
Other Other 32% +125P -176P +207P -254P -262P -50T +85Y +84G +85G +38P +139P -183P +205P -247P
view details
Other Other 32% +125P -176P +207P -254P -262P -50T +85Y +84G +85G +38P +139P -183P +205P -247P
view details
Other Other 32% +125P -176P +207P -254P -262P -50T +85Y +84G +85G +38P +139P -183P +205P -247P
view details
Other Other 32% +125P -176P +207P -254P -262P -50T +85Y +84G +85G +38P +139P -183P +205P -247P
view details
Other Other 32% +125P -176P +207P -254P -262P -50T +85Y +84G +85G +38P +139P -183P +205P -247P
view details
Other Other 32% +125P -176P +207P -254P -262P -50T +85Y +84G +85G +38P +139P -183P +205P -247P
view details
Other Other 32% +125P -176P +207P -254P -262P -50T +85Y +84G +85G +38P +139P -183P +205P -247P
view details
Other Other 32% +125P -176P +207P -254P -262P -50T +85Y +84G +85G +38P +139P -183P +205P -247P
view details
Other Other 32% +125P -176P +207P -254P -262P -50T +85Y +84G +85G +38P +139P -183P +205P -247P
view details
Other Other 32% +125P -176P +207P -254P -262P -50T +85Y +84G +85G +38P +139P -183P +205P -247P
view details
Other Other 32% +125P -176P +207P -254P -262P -50T +85Y +84G +85G +38P +139P -183P +205P -247P
view details
Other Other 32% +125P -176P +207P -254P -262P -50T +85Y +84G +85G +38P +139P -183P +205P -247P
view details
Other Other 32% +125P -176P +207P -254P -262P -50T +85Y +84G +85G +38P +139P -183P +205P -247P
view details
Other Other 32% +125P -176P +207P -254P -262P -50T +85Y +84G +85G +38P +139P -183P +205P -247P
view details
Other Other 32% +125P -176P +207P -254P -262P -50T +85Y +84G +85G +38P +139P -183P +205P -247P
view details
Other Other 32% +125P -176P +207P -254P -262P -50T +85Y +84G +85G +38P +139P -183P +205P -247P
view details
Other Other 32% +125P -176P +207P -254P -262P -50T +85Y +84G +85G +38P +139P -183P +205P -247P
view details
Other Other 32% +125P -176P +207P -254P -262P -50T +85Y +84G +85G +38P +139P -183P +205P -247P
view details
Other Other 32% +125P -176P +207P -254P -262P -50T +85Y +84G +85G +38P +139P -183P +205P -247P
view details
Other Other 32% +125P -176P +207P -254P -262P -50T +85Y +84G +85G +38P +139P -183P +205P -247P
view details
Other Other 32% +125P -176P +207P -254P -262P -50T +85Y +84G +85G +38P +139P -183P +205P -247P
view details
Other Other 32% +125P -176P +207P -254P -262P -50T +85Y +84G +85G +38P +139P -183P +205P -247P
view details
Other Other 32% +125P -176P +207P -254P -262P -50T +85Y +84G +85G +38P +139P -183P +205P -247P
view details
Other Other 32% +125P -176P +207P -254P -262P -50T +85Y +84G +85G +38P +139P -183P +205P -247P
view details
Other Other 32% +125P -176P +207P -254P -262P -50T +85Y +84G +85G +38P +139P -183P +205P -247P
view details
Other Other 32% +125P -176P +207P -254P -262P -50T +85Y +84G +85G +38P +139P -183P +205P -247P
Interpreting sequences
Chain G Sequence
ASAAKGDHGGGARTWRFLTFGLALPSVALCTLNSWLHSGHRERPAFIPYHHLRIRTKPFSWGDGNHTFFHNPRVNPLPTGYEK
Chain G Sequence
HQTHAYHMVNPSPWPLTGALSALLMTSGLTMWFHFNSMTLLMIGLTTNMLTMYQWWRDVIRESTFQGHHTPAVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPLEVPLLNTSVLLASGVSITWAHHSLMEGDRKHMLQALFITITLGVYFTLLQASEYYEAPFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHFVDVVWLFLYVSIYWWGS
Chain G Sequence
ASAAKGDHGGGARTWRFLTFGLALPSVALCTLNSWLHSGHRERPAFIPYHHLRIRTKPFSWGDGNHTFFHNPRVNPLPTGYEK
Chain G Sequence
HYEEGPGKNIPFSVENKWRLLAMMTLFFGSGFAAPFFIVRHQLLKK
sequence length 84,259,84,46
structure length 83,259,83,46
publication title Complex structure of cytochrome c-cytochrome c oxidase reveals a novel protein-protein interaction mode
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
pdb deposition date2016-03-24
LinkProt deposition date2017-01-14
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling