| Link type | Probability | Chain C piercings | Chain G piercings | Chain P piercings | Chain U piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
|
Other | 36% | +140P -172P +89U -262U | |||||||||||
| view details |
|
Other | 36% | +140P -172P +89U -262U | |||||||||||
| view details |
|
Other | 36% | +140P -172P +89U -262U | |||||||||||
| view details |
|
Other | 36% | +140P -172P +89U -262U | |||||||||||
| view details |
|
Other | 36% | +140P -172P +89U -262U | |||||||||||
| view details |
|
Other | 36% | +140P -172P +89U -262U | |||||||||||
| view details |
|
Other | 36% | +140P -172P +89U -262U | |||||||||||
| view details |
|
Other | 36% | +140P -172P +89U -262U | |||||||||||
| view details |
|
Other | 36% | +140P -172P +89U -262U | |||||||||||
| view details |
|
Other | 36% | +140P -172P +89U -262U | |||||||||||
| view details |
|
Other | 36% | +140P -172P +89U -262U | |||||||||||
| view details |
|
Other | 36% | +140P -172P +89U -262U | |||||||||||
| view details |
|
Other | 36% | +140P -172P +89U -262U | |||||||||||
| view details |
|
Other | 36% | +140P -172P +89U -262U | |||||||||||
| view details |
|
Other | 36% | +140P -172P +89U -262U | |||||||||||
| view details |
|
Other | 36% | +140P -172P +89U -262U | |||||||||||
| view details |
|
Other | 36% | +140P -172P +89U -262U | |||||||||||
| view details |
|
Other | 36% | +140P -172P +89U -262U | |||||||||||
| view details |
|
Other | 36% | +140P -172P +89U -262U | |||||||||||
| view details |
|
Other | 36% | +140P -172P +89U -262U | |||||||||||
| view details |
|
Other | 36% | +140P -172P +89U -262U | |||||||||||
| view details |
|
Other | 36% | +140P -172P +89U -262U | |||||||||||
| view details |
|
Other | 36% | +140P -172P +89U -262U | |||||||||||
| view details |
|
Other | 36% | +140P -172P +89U -262U | |||||||||||
| view details |
|
Other | 36% | +140P -172P +89U -262U | |||||||||||
| view details |
|
Other | 36% | +140P -172P +89U -262U | |||||||||||
| view details |
|
Other | 36% | +140P -172P +89U -262U | |||||||||||
| view details |
|
Other | 36% | +140P -172P +89U -262U | |||||||||||
| view details |
|
Other | 36% | +140P -172P +89U -262U | |||||||||||
| view details |
|
Other | 36% | +140P -172P +89U -262U | |||||||||||
| view details |
|
Other | 36% | +140P -172P +89U -262U | |||||||||||
| view details |
|
Other | 36% | +140P -172P +89U -262U | |||||||||||
| view details |
|
Other | 36% | +140P -172P +89U -262U | |||||||||||
| view details |
|
Other | 36% | +140P -172P +89U -262U | |||||||||||
| view details |
|
Other | 36% | +140P -172P +89U -262U | |||||||||||
| view details |
|
Other | 36% | +140P -172P +89U -262U | |||||||||||
| view details |
|
Other | 36% | +140P -172P +89U -262U | |||||||||||
| view details |
|
Other | 36% | +140P -172P +89U -262U | |||||||||||
| view details |
|
Other | 36% | +140P -172P +89U -262U | |||||||||||
| view details |
|
Other | 36% | +140P -172P +89U -262U | |||||||||||
| view details |
|
Other | 36% | +140P -172P +89U -262U | |||||||||||
| view details |
|
Other | 36% | +140P -172P +89U -262U | |||||||||||
Chain C Sequence |
HQTHAYHMVNPSPWPLTGALSALLMTSGLTMWFHFNSMTLLMIGLTTNMLTMYQWWRDVIRESTFQGHHTPAVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPLEVPLLNTSVLLASGVSITWAHHSLMEGDRKHMLQALFITITLGVYFTLLQASEYYEAPFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHFVDVVWLFLYVSIYWWGS |
Chain C Sequence |
ASAAKGDHGGGARTWRFLTFGLALPSVALCTLNSWLHSGHRERPAFIPYHHLRIRTKPFSWGDGNHTFFHNPRVNPLPTGYEK |
Chain C Sequence |
HQTHAYHMVNPSPWPLTGALSALLMTSGLTMWFHFNSMTLLMIGLTTNMLTMYQWWRDVIRESTFQGHHTPAVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPLEVPLLNTSVLLASGVSITWAHHSLMEGDRKHMLQALFITITLGVYFTLLQASEYYEAPFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHFVDVVWLFLYVSIYWWGS |
Chain C Sequence |
KIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI |
| sequence length | 259,84,259,79 |
| structure length | 259,83,259,79 |
| publication title |
Complex structure of cytochrome c-cytochrome c oxidase reveals a novel protein-protein interaction mode
pubmed doi rcsb |
| molecule tags | Oxidoreductase |
| molecule keywords | Cytochrome c oxidase subunit 1 |
| pdb deposition date | 2016-03-24 |
| LinkProt deposition date | 2017-01-14 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...