Link type | Probability | Chain C piercings | Chain G piercings | Chain P piercings | Chain T piercings | ||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
Other | 37% | -34G -261P | |||||||||||
view details |
![]() |
Other | 37% | -34G -261P | |||||||||||
view details |
![]() |
Other | 37% | -34G -261P | |||||||||||
view details |
![]() |
Other | 37% | -34G -261P | |||||||||||
view details |
![]() |
Other | 37% | -34G -261P | |||||||||||
view details |
![]() |
Other | 37% | -34G -261P | |||||||||||
view details |
![]() |
Other | 37% | -34G -261P | |||||||||||
view details |
![]() |
Other | 37% | -34G -261P | |||||||||||
view details |
![]() |
Other | 37% | -34G -261P | |||||||||||
view details |
![]() |
Other | 37% | -34G -261P | |||||||||||
view details |
![]() |
Other | 37% | -34G -261P | |||||||||||
view details |
![]() |
Other | 37% | -34G -261P | |||||||||||
view details |
![]() |
Other | 37% | -34G -261P | |||||||||||
view details |
![]() |
Other | 37% | -34G -261P | |||||||||||
view details |
![]() |
Other | 37% | -34G -261P | |||||||||||
view details |
![]() |
Other | 37% | -34G -261P | |||||||||||
view details |
![]() |
Other | 37% | -34G -261P | |||||||||||
view details |
![]() |
Other | 37% | -34G -261P | |||||||||||
view details |
![]() |
Other | 37% | -34G -261P | |||||||||||
view details |
![]() |
Other | 37% | -34G -261P | |||||||||||
view details |
![]() |
Other | 37% | -34G -261P | |||||||||||
view details |
![]() |
Other | 37% | -34G -261P | |||||||||||
view details |
![]() |
Other | 37% | -34G -261P | |||||||||||
view details |
![]() |
Other | 37% | -34G -261P | |||||||||||
view details |
![]() |
Other | 37% | -34G -261P | |||||||||||
view details |
![]() |
Other | 37% | -34G -261P | |||||||||||
view details |
![]() |
Other | 37% | -34G -261P | |||||||||||
view details |
![]() |
Other | 37% | -34G -261P | |||||||||||
view details |
![]() |
Other | 37% | -34G -261P | |||||||||||
view details |
![]() |
Other | 37% | -34G -261P | |||||||||||
view details |
![]() |
Other | 37% | -34G -261P | |||||||||||
view details |
![]() |
Other | 37% | -34G -261P | |||||||||||
view details |
![]() |
Other | 37% | -34G -261P | |||||||||||
view details |
![]() |
Other | 37% | -34G -261P | |||||||||||
view details |
![]() |
Other | 37% | -34G -261P | |||||||||||
view details |
![]() |
Other | 37% | -34G -261P | |||||||||||
view details |
![]() |
Other | 37% | -34G -261P | |||||||||||
view details |
![]() |
Other | 37% | -34G -261P | |||||||||||
view details |
![]() |
Other | 37% | -34G -261P | |||||||||||
view details |
![]() |
Other | 37% | -34G -261P | |||||||||||
view details |
![]() |
Other | 37% | -34G -261P | |||||||||||
view details |
![]() |
Other | 37% | -34G -261P | |||||||||||
view details |
![]() |
Other | 37% | -34G -261P | |||||||||||
view details |
![]() |
Other | 37% | -34G -261P | |||||||||||
view details |
![]() |
Other | 37% | -34G -261P |
Chain C Sequence |
HQTHAYHMVNPSPWPLTGALSALLMTSGLTMWFHFNSMTLLMIGLTTNMLTMYQWWRDVIRESTFQGHHTPAVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPLEVPLLNTSVLLASGVSITWAHHSLMEGDRKHMLQALFITITLGVYFTLLQASEYYEAPFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHFVDVVWLFLYVSIYWWGS |
Chain C Sequence |
ASAAKGDHGGGARTWRFLTFGLALPSVALCTLNSWLHSGHRERPAFIPYHHLRIRTKPFSWGDGNHTFFHNPRVNPLPTGYEK |
Chain C Sequence |
HQTHAYHMVNPSPWPLTGALSALLMTSGLTMWFHFNSMTLLMIGLTTNMLTMYQWWRDVIRESTFQGHHTPAVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPLEVPLLNTSVLLASGVSITWAHHSLMEGDRKHMLQALFITITLGVYFTLLQASEYYEAPFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHFVDVVWLFLYVSIYWWGS |
Chain C Sequence |
ASAAKGDHGGGARTWRFLTFGLALPSVALCTLNSWLHSGHRERPAFIPYHHLRIRTKPFSWGDGNHTFFHNPRVNPLPTGYEK |
sequence length | 259,84,259,84 |
structure length | 259,83,259,83 |
publication title |
Complex structure of cytochrome c-cytochrome c oxidase reveals a novel protein-protein interaction mode
pubmed doi rcsb |
molecule tags | Oxidoreductase |
molecule keywords | Cytochrome c oxidase subunit 1 |
pdb deposition date | 2016-03-24 |
LinkProt deposition date | 2017-01-14 |
#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...