| Link type | Probability | Chain C piercings | Chain F piercings | Chain S piercings | Chain W piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Other | 61% | +98F +261S +99W | +262C -49S -262W | +99C +99F | |||||||||
| view details |
|
Other | 61% | +98F +261S +99W | +262C -49S -262W | +99C +99F | |||||||||
| view details |
|
Other | 61% | +98F +261S +99W | +262C -49S -262W | +99C +99F | |||||||||
| view details |
|
Other | 61% | +98F +261S +99W | +262C -49S -262W | +99C +99F | |||||||||
| view details |
|
Other | 61% | +98F +261S +99W | +262C -49S -262W | +99C +99F | |||||||||
| view details |
|
Other | 61% | +98F +261S +99W | +262C -49S -262W | +99C +99F | |||||||||
| view details |
|
Other | 61% | +98F +261S +99W | +262C -49S -262W | +99C +99F | |||||||||
| view details |
|
Other | 61% | +98F +261S +99W | +262C -49S -262W | +99C +99F | |||||||||
| view details |
|
Other | 61% | +98F +261S +99W | +262C -49S -262W | +99C +99F | |||||||||
| view details |
|
Other | 61% | +98F +261S +99W | +262C -49S -262W | +99C +99F | |||||||||
| view details |
|
Other | 61% | +98F +261S +99W | +262C -49S -262W | +99C +99F | |||||||||
| view details |
|
Other | 61% | +98F +261S +99W | +262C -49S -262W | +99C +99F | |||||||||
| view details |
|
Other | 61% | +98F +261S +99W | +262C -49S -262W | +99C +99F | |||||||||
| view details |
|
Other | 61% | +98F +261S +99W | +262C -49S -262W | +99C +99F | |||||||||
| view details |
|
Other | 61% | +98F +261S +99W | +262C -49S -262W | +99C +99F | |||||||||
| view details |
|
Other | 61% | +98F +261S +99W | +262C -49S -262W | +99C +99F | |||||||||
| view details |
|
Other | 61% | +98F +261S +99W | +262C -49S -262W | +99C +99F | |||||||||
Chain C Sequence |
HQTHAYHMVNPSPWPLTGALSALLMTSGLTMWFHFNSMTLLMIGLTTNMLTMYQWWRDVIRESTFQGHHTPAVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPLEVPLLNTSVLLASGVSITWAHHSLMEGDRKHMLQALFITITLGVYFTLLQASEYYEAPFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHFVDVVWLFLYVSIYWWGS |
Chain C Sequence |
ASGGGVPTDEEQATGLEREVMLAARKGQDPYNILAPKATSGTKEDPNLVPSITNKRIVGCICEEDNSTVIWFWLHKGEAQRCPSCGTHYKLVPHQLAH |
Chain C Sequence |
ASGGGVPTDEEQATGLEREVMLAARKGQDPYNILAPKATSGTKEDPNLVPSITNKRIVGCICEEDNSTVIWFWLHKGEAQRCPSCGTHYKLVPHQLAH |
Chain C Sequence |
FENRVAEKQKLFQEDNGLPVHLKGGATDNILYRVTMTLCLGGTLYSLYCLGWASFPHK |
| sequence length | 259,98,98,58 |
| structure length | 259,98,98,58 |
| publication title |
Complex structure of cytochrome c-cytochrome c oxidase reveals a novel protein-protein interaction mode
pubmed doi rcsb |
| molecule tags | Oxidoreductase |
| molecule keywords | Cytochrome c oxidase subunit 1 |
| pdb deposition date | 2016-03-24 |
| LinkProt deposition date | 2017-01-14 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
