5IY5BQTU

Electron transfer complex of cytochrome c and cytochrome c oxidase at 2.0 angstrom resolution
Link type Probability Chain B piercings Chain Q piercings Chain T piercings Chain U piercings
view details
Other Other 31% -95U +143U -190U +212U
view details
Other Other 31% -95U +143U -190U +212U
view details
Other Other 31% -95U +143U -190U +212U
view details
Other Other 31% -95U +143U -190U +212U
view details
Other Other 31% -95U +143U -190U +212U
view details
Other Other 31% -95U +143U -190U +212U
view details
Other Other 31% -95U +143U -190U +212U
view details
Other Other 31% -95U +143U -190U +212U
view details
Other Other 31% -95U +143U -190U +212U
view details
Other Other 31% -95U +143U -190U +212U
view details
Other Other 31% -95U +143U -190U +212U
view details
Other Other 31% -95U +143U -190U +212U
view details
Other Other 31% -95U +143U -190U +212U
view details
Other Other 31% -95U +143U -190U +212U
view details
Other Other 31% -95U +143U -190U +212U
view details
Other Other 31% -95U +143U -190U +212U
view details
Other Other 31% -95U +143U -190U +212U
view details
Other Other 31% -95U +143U -190U +212U
view details
Other Other 31% -95U +143U -190U +212U
view details
Other Other 31% -95U +143U -190U +212U
view details
Other Other 31% -95U +143U -190U +212U
view details
Other Other 31% -95U +143U -190U +212U
view details
Other Other 31% -95U +143U -190U +212U
view details
Other Other 31% -95U +143U -190U +212U
view details
Other Other 31% -95U +143U -190U +212U
view details
Other Other 31% -95U +143U -190U +212U
Interpreting sequences
Chain B Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Chain B Sequence
SVVKSEDYALPSYVDRRDYPLPDVAHVKNLSASQKALKEKEKASWSSLSIDEKVELYRLKFKESFAEMNRSTNEWKTVVGAAMFFIGFTALLLIWEKHYVYGPIPHTFEEEWVAKQTKRMLDMKVAPIQGFSAKWDYDKNEWKK
Chain B Sequence
ASAAKGDHGGGARTWRFLTFGLALPSVALCTLNSWLHSGHRERPAFIPYHHLRIRTKPFSWGDGNHTFFHNPRVNPLPTGYEK
Chain B Sequence
KIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI
sequence length 226,144,84,79
structure length 226,144,83,79
publication title Complex structure of cytochrome c-cytochrome c oxidase reveals a novel protein-protein interaction mode
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
pdb deposition date2016-03-24
LinkProt deposition date2017-01-14
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling