5IY5AHJL

Electron transfer complex of cytochrome c and cytochrome c oxidase at 2.0 angstrom resolution
Link type Probability Chain A piercings Chain H piercings Chain J piercings Chain L piercings
view details
Other Other 32% +25H -53H -86H -515J +59L -32A +392A +515A -47J +38L -48L -340L +392L -424L
view details
Other Other 32% +25H -53H -86H -515J +59L -32A +392A +515A -47J +38L -48L -340L +392L -424L
view details
Other Other 32% +25H -53H -86H -515J +59L -32A +392A +515A -47J +38L -48L -340L +392L -424L
view details
Other Other 32% +25H -53H -86H -515J +59L -32A +392A +515A -47J +38L -48L -340L +392L -424L
view details
Other Other 32% +25H -53H -86H -515J +59L -32A +392A +515A -47J +38L -48L -340L +392L -424L
view details
Other Other 32% +25H -53H -86H -515J +59L -32A +392A +515A -47J +38L -48L -340L +392L -424L
view details
Other Other 32% +25H -53H -86H -515J +59L -32A +392A +515A -47J +38L -48L -340L +392L -424L
view details
Other Other 32% +25H -53H -86H -515J +59L -32A +392A +515A -47J +38L -48L -340L +392L -424L
view details
Other Other 32% +25H -53H -86H -515J +59L -32A +392A +515A -47J +38L -48L -340L +392L -424L
view details
Other Other 32% +25H -53H -86H -515J +59L -32A +392A +515A -47J +38L -48L -340L +392L -424L
view details
Other Other 32% +25H -53H -86H -515J +59L -32A +392A +515A -47J +38L -48L -340L +392L -424L
view details
Other Other 32% +25H -53H -86H -515J +59L -32A +392A +515A -47J +38L -48L -340L +392L -424L
view details
Other Other 32% +25H -53H -86H -515J +59L -32A +392A +515A -47J +38L -48L -340L +392L -424L
view details
Other Other 32% +25H -53H -86H -515J +59L -32A +392A +515A -47J +38L -48L -340L +392L -424L
view details
Other Other 32% +25H -53H -86H -515J +59L -32A +392A +515A -47J +38L -48L -340L +392L -424L
view details
Other Other 32% +25H -53H -86H -515J +59L -32A +392A +515A -47J +38L -48L -340L +392L -424L
view details
Other Other 32% +25H -53H -86H -515J +59L -32A +392A +515A -47J +38L -48L -340L +392L -424L
view details
Other Other 32% +25H -53H -86H -515J +59L -32A +392A +515A -47J +38L -48L -340L +392L -424L
view details
Other Other 32% +25H -53H -86H -515J +59L -32A +392A +515A -47J +38L -48L -340L +392L -424L
view details
Other Other 32% +25H -53H -86H -515J +59L -32A +392A +515A -47J +38L -48L -340L +392L -424L
view details
Other Other 32% +25H -53H -86H -515J +59L -32A +392A +515A -47J +38L -48L -340L +392L -424L
view details
Other Other 32% +25H -53H -86H -515J +59L -32A +392A +515A -47J +38L -48L -340L +392L -424L
view details
Other Other 32% +25H -53H -86H -515J +59L -32A +392A +515A -47J +38L -48L -340L +392L -424L
view details
Other Other 32% +25H -53H -86H -515J +59L -32A +392A +515A -47J +38L -48L -340L +392L -424L
view details
Other Other 32% +25H -53H -86H -515J +59L -32A +392A +515A -47J +38L -48L -340L +392L -424L
view details
Other Other 32% +25H -53H -86H -515J +59L -32A +392A +515A -47J +38L -48L -340L +392L -424L
view details
Other Other 32% +25H -53H -86H -515J +59L -32A +392A +515A -47J +38L -48L -340L +392L -424L
view details
Other Other 32% +25H -53H -86H -515J +59L -32A +392A +515A -47J +38L -48L -340L +392L -424L
view details
Other Other 32% +25H -53H -86H -515J +59L -32A +392A +515A -47J +38L -48L -340L +392L -424L
view details
Other Other 32% +25H -53H -86H -515J +59L -32A +392A +515A -47J +38L -48L -340L +392L -424L
view details
Other Other 32% +25H -53H -86H -515J +59L -32A +392A +515A -47J +38L -48L -340L +392L -424L
view details
Other Other 32% +25H -53H -86H -515J +59L -32A +392A +515A -47J +38L -48L -340L +392L -424L
view details
Other Other 32% +25H -53H -86H -515J +59L -32A +392A +515A -47J +38L -48L -340L +392L -424L
view details
Other Other 32% +25H -53H -86H -515J +59L -32A +392A +515A -47J +38L -48L -340L +392L -424L
view details
Other Other 32% +25H -53H -86H -515J +59L -32A +392A +515A -47J +38L -48L -340L +392L -424L
view details
Other Other 32% +25H -53H -86H -515J +59L -32A +392A +515A -47J +38L -48L -340L +392L -424L
view details
Other Other 32% +25H -53H -86H -515J +59L -32A +392A +515A -47J +38L -48L -340L +392L -424L
view details
Other Other 32% +25H -53H -86H -515J +59L -32A +392A +515A -47J +38L -48L -340L +392L -424L
Interpreting sequences
Chain A Sequence
FINRWLFSTNHKDIGTLYLLFGAWAGMVGTALSLLIRAELGQPGTLLGDDQIYNVVVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSMVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGVSSILGAINFITTIINMKPPAMSQYQTPLFVWSVMITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKVFSWLATLHGGNIKWSPAMMWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWFPLFSGYTLNDTWAKIHFAIMFVGVNMTFFPQHFLGLSGMPRRYSDYPDAYTMWNTISSMGSFISLTAVMLMVFIIWEAFASKREVLTVDLTTTNLEWLNGCPPPYHTFEEPTYVNLK
Chain A Sequence
KIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI
Chain A Sequence
FENRVAEKQKLFQEDNGLPVHLKGGATDNILYRVTMTLCLGGTLYSLYCLGWASFPHK
Chain A Sequence
HYEEGPGKNIPFSVENKWRLLAMMTLFFGSGFAAPFFIVRHQLLKK
sequence length 513,79,58,46
structure length 513,79,58,46
publication title Complex structure of cytochrome c-cytochrome c oxidase reveals a novel protein-protein interaction mode
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
pdb deposition date2016-03-24
LinkProt deposition date2017-01-14
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling