5IWWABCD

Crystal structure of rna editing factor of designer pls-type ppr/9r protein in complex with morf9/rip9
Link type Probability Chain A piercings Chain B piercings Chain C piercings Chain D piercings
view details
Other Other 46% +253D -315D
view details
Other Other 46% +253D -315D
view details
Other Other 46% +253D -315D
view details
Other Other 46% +253D -315D
view details
Other Other 46% +253D -315D
view details
Other Other 46% +253D -315D
view details
Other Other 46% +253D -315D
view details
Other Other 46% +253D -315D
view details
Other Other 46% +253D -315D
view details
Other Other 46% +253D -315D
view details
Other Other 46% +253D -315D
view details
Other Other 46% +253D -315D
view details
Other Other 46% +253D -315D
view details
Other Other 46% +253D -315D
view details
Other Other 46% +253D -315D
view details
Other Other 46% +253D -315D
view details
Other Other 46% +253D -315D
view details
Other Other 46% +253D -315D
view details
Other Other 46% +253D -315D
view details
Other Other 46% +253D -315D
view details
Other Other 46% +253D -315D
view details
Other Other 46% +253D -315D
view details
Other Other 46% +253D -315D
view details
Other Other 46% +253D -315D
view details
Other Other 46% +253D -315D
view details
Other Other 46% +253D -315D
view details
Other Other 46% +253D -315D
view details
Other Other 46% +253D -315D
view details
Other Other 46% +253D -315D
view details
Other Other 46% +253D -315D
view details
Other Other 46% +253D -315D
view details
Other Other 46% +253D -315D
view details
Other Other 46% +253D -315D
view details
Other Other 46% +253D -315D
view details
Other Other 46% +253D -315D
view details
Other Other 46% +253D -315D
view details
Other Other 46% +253D -315D
Interpreting sequences
Chain A Sequence
TIMLPGSDYNHWLIVMEFPKDPAPSRDQMIDTYLNTLATVLGSMEEAKKNMYAFSTTTYTGFQCTIDEETSEKFKGLPGVLWVLPDSYIDVKNKDYGGDKYINGEIIPST
Chain A Sequence
TIMLPGSDYNHWLIVMEFPKDPAPSRDQMIDTYLNTLATVLGSMEEAKKNMYAFSTTTYTGFQCTIDEETSEKFKGLPGVLWVLPDSYIDVKNKDYGGDKYINGEIIPST
Chain A Sequence
IMLPGSDYNHWLIVMEFPKDPAPSRDQMIDTYLNTLATVLGSMEEAKKNMYAFSTTTYTGFQCTIDEETSEKFKGLPGVLWVLPDSYIDVKNKDYGGDKYINGEIIPS
Chain A Sequence
PTVVTYNTLIDGLCKAGKLDEALKLFEEMVEKGIKPDEFTFSSVLKACARLGALELGKQIHGYVIKSGFEGNVVVYNALIDMYSKCGLLEEARKVFDEMPEKDVVTYNTLIDGLCKAGKLDEALKLFEEMVEKGIKPDEFTFSSVLKACARLGALELGKQIHGYVIKSGFESNVVVYNALIDMYSKCGLLEEARKVFDEMPEKDVVTYNTLIDGLCKAGKLDEALKLFEEMVEKGIKPDEFTFSSVLKACARLGALELGKQIHGYVIKSGFESNVVVYNALIDMYSKCGLLEEARKVFDE
sequence length 110,110,108,300
structure length 110,110,108,300
publication title Structural basis for designer pentatricopeptide repeat proteins interaction with MORF protein
rcsb
molecule tags Rna binding protein
molecule keywords Multiple organellar RNA editing factor 9, chloroplastic
source organism Arabidopsis thaliana
pdb deposition date2016-03-23
LinkProt deposition date2017-04-01
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling