5I7CABCD

Centrosomin-motif 2 (cm2) domain of drosophila melanogaster centrosomin (cnn)
Link type Probability Chain A piercings Chain B piercings Chain C piercings Chain D piercings
view details
Other Other 39% -1122C +1140C +1126D -1141D
view details
Other Other 39% -1122C +1140C +1126D -1141D
view details
Other Other 39% -1122C +1140C +1126D -1141D
view details
Other Other 39% -1122C +1140C +1126D -1141D
view details
Other Other 39% -1122C +1140C +1126D -1141D
view details
Other Other 39% -1122C +1140C +1126D -1141D
view details
Other Other 39% -1122C +1140C +1126D -1141D
view details
Other Other 39% -1122C +1140C +1126D -1141D
view details
Other Other 39% -1122C +1140C +1126D -1141D
view details
Other Other 39% -1122C +1140C +1126D -1141D
view details
Other Other 39% -1122C +1140C +1126D -1141D
view details
Other Other 39% -1122C +1140C +1126D -1141D
view details
Other Other 39% -1122C +1140C +1126D -1141D
view details
Other Other 39% -1122C +1140C +1126D -1141D
view details
Other Other 39% -1122C +1140C +1126D -1141D
view details
Other Other 39% -1122C +1140C +1126D -1141D
Interpreting sequences
Chain A Sequence
HDCAKVDLENAELRRKLIRTKRAFEDTYEKLRMANKAKAQVEKDIKNQILKTHNVLRNV
Chain A Sequence
HDCAKVDLENAELRRKLIRTKRAFEDTYEKLRMANKAKAQVEKDIKNQILKTHNVLRNV
Chain A Sequence
HDCAKVDLENAELRRKLIRTKRAFEDTYEKLRMANKAKAQVEKDIKNQILKTHNVLRNV
Chain A Sequence
HDCAKVDLENAELRRKLIRTKRAFEDTYEKLRMANKAKAQVEKDIKNQILKTHNVLRN
sequence length 59,59,59,58
structure length 59,59,59,58
publication title Structure of the Drosophila Cnn CM2 domain provides atomic insight into mitotic centrosome assembly
rcsb
molecule tags Structural protein
molecule keywords Centrosomin
source organism Drosophila melanogaster
pdb deposition date2016-02-17
LinkProt deposition date2017-03-10
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling