5I0IABG

Crystal structure of myosin x motor domain with 2iq motifs in pre-powerstroke state
Link type Probability Chain A piercings Chain B piercings Chain G piercings
view details
Hopf.1 U Ring Hopf.1 U Ring 30% -105B -198B +223B -240B +418B -434B +456B -491B +619B -639B +652B +787B +675G -786G +84A +771G
view details
Hopf.1 U Ring Hopf.1 U Ring 30% -105B -198B +223B -240B +418B -434B +456B -491B +619B -639B +652B +787B +675G -786G +84A +771G
view details
Hopf.1 U Ring Hopf.1 U Ring 30% -105B -198B +223B -240B +418B -434B +456B -491B +619B -639B +652B +787B +675G -786G +84A +771G
view details
Hopf.1 U Ring Hopf.1 U Ring 30% -105B -198B +223B -240B +418B -434B +456B -491B +619B -639B +652B +787B +675G -786G +84A +771G
view details
Hopf.1 U Ring Hopf.1 U Ring 30% -105B -198B +223B -240B +418B -434B +456B -491B +619B -639B +652B +787B +675G -786G +84A +771G
view details
Hopf.1 U Ring Hopf.1 U Ring 30% -105B -198B +223B -240B +418B -434B +456B -491B +619B -639B +652B +787B +675G -786G +84A +771G
view details
Hopf.1 U Ring Hopf.1 U Ring 30% -105B -198B +223B -240B +418B -434B +456B -491B +619B -639B +652B +787B +675G -786G +84A +771G
view details
Hopf.1 U Ring Hopf.1 U Ring 30% -105B -198B +223B -240B +418B -434B +456B -491B +619B -639B +652B +787B +675G -786G +84A +771G
view details
Hopf.1 U Ring Hopf.1 U Ring 30% -105B -198B +223B -240B +418B -434B +456B -491B +619B -639B +652B +787B +675G -786G +84A +771G
view details
Hopf.1 U Ring Hopf.1 U Ring 30% -105B -198B +223B -240B +418B -434B +456B -491B +619B -639B +652B +787B +675G -786G +84A +771G
view details
Hopf.1 U Ring Hopf.1 U Ring 30% -105B -198B +223B -240B +418B -434B +456B -491B +619B -639B +652B +787B +675G -786G +84A +771G
view details
Hopf.1 U Ring Hopf.1 U Ring 30% -105B -198B +223B -240B +418B -434B +456B -491B +619B -639B +652B +787B +675G -786G +84A +771G
view details
Hopf.1 U Ring Hopf.1 U Ring 30% -105B -198B +223B -240B +418B -434B +456B -491B +619B -639B +652B +787B +675G -786G +84A +771G
view details
Hopf.1 U Ring Hopf.1 U Ring 30% -105B -198B +223B -240B +418B -434B +456B -491B +619B -639B +652B +787B +675G -786G +84A +771G
view details
Hopf.1 U Ring Hopf.1 U Ring 30% -105B -198B +223B -240B +418B -434B +456B -491B +619B -639B +652B +787B +675G -786G +84A +771G
view details
Hopf.1 U Ring Hopf.1 U Ring 30% -105B -198B +223B -240B +418B -434B +456B -491B +619B -639B +652B +787B +675G -786G +84A +771G
view details
Hopf.1 U Ring Hopf.1 U Ring 30% -105B -198B +223B -240B +418B -434B +456B -491B +619B -639B +652B +787B +675G -786G +84A +771G
view details
Hopf.1 U Ring Hopf.1 U Ring 30% -105B -198B +223B -240B +418B -434B +456B -491B +619B -639B +652B +787B +675G -786G +84A +771G
view details
Hopf.1 U Ring Hopf.1 U Ring 30% -105B -198B +223B -240B +418B -434B +456B -491B +619B -639B +652B +787B +675G -786G +84A +771G
view details
Hopf.1 U Ring Hopf.1 U Ring 30% -105B -198B +223B -240B +418B -434B +456B -491B +619B -639B +652B +787B +675G -786G +84A +771G
view details
Hopf.1 U Ring Hopf.1 U Ring 30% -105B -198B +223B -240B +418B -434B +456B -491B +619B -639B +652B +787B +675G -786G +84A +771G
view details
Hopf.1 U Ring Hopf.1 U Ring 30% -105B -198B +223B -240B +418B -434B +456B -491B +619B -639B +652B +787B +675G -786G +84A +771G
view details
Hopf.1 U Ring Hopf.1 U Ring 30% -105B -198B +223B -240B +418B -434B +456B -491B +619B -639B +652B +787B +675G -786G +84A +771G
view details
Hopf.1 U Ring Hopf.1 U Ring 30% -105B -198B +223B -240B +418B -434B +456B -491B +619B -639B +652B +787B +675G -786G +84A +771G
Interpreting sequences
Chain A Sequence
NFFTEGTRVWLRENGQHFPSTVNSCAEGIVVFRTDYGQVFTYKQSTITHQKVTAMHPTNEEGVDDMASLTELHGGSIMYNLFQRYKRNQIYTYIGSILASVNPYQPIAGLYEPATMEQYSRRHLGELPPHIFAIANECYRCLWKRHDNQCILISGESGAGKTESTKLILKFLSVISQQSLELSLKEKTSCVERAILESSPIMEAFGNAKTVYNNNSSRFGKFVQLNICQKGNIQGGRIVDYLLEKNRVVRQNPGERNYHIFYALLAGLEHEEREEFYLSTPENYHYLNQSGCVEDKTISDQESFREVITAMDVMQFSKEEVREVSRLLAGILHLGNIEFITAGGAQVSFKTALGRSAELLGLDPTQLTDALTQRSMFLRGEEILTPLNVQQAVDSRDSLAMALYACCFEWVIKKINSRIKGNEDFKSIGILDIFGFENFEVNHFEQFNINYANEKLQEYFNKHIFSLEQLEYSREGLVWEDIDWIDNGECLDLIEKKLGLLALINEESHFPQATDSTLLEKLHSQHANNHFYVKPRVAVNNFGVKHYAGEVQYDVRGILEKNRDTFRDDLLNLLRESRFDFIYDLFEHVSSRNNQDTLKCGSKHRRPTVSSQFKDSLHSLMATLSSSNPFFVRCIKPNMQKMPDQFDQAVVLNQLRYSGMLETVRIRKAGYAVRRPFQDFYKRYKVLMRNLALPEDVRGKCTSLLQLYDASNSEWQLGKTKVFLRESLEQKLEKRREEEVSHAAMVIRAHVLGFLARKQYRKVLYCVVIIQKNYRAFLLRRRFL
Chain A Sequence
NFFTEGTRVWLRENGQHFPSTVNSCAEGIVVFRTDYGQVFTYKQSTITHQKVTAMHPTNEEGVDDMASLTELHGGSIMYNLFQRYKRNQIYTYIGSILASVNPYQPIAGLYEPATMEQYSRRHLGELPPHIFAIANECYRCLWKRHDNQCILISGESGAGKTESTKLILKFLSVISQQSLELSLKEKTSCVERAILESSPIMEAFGNAKTVYNNNSSRFGKFVQLNICQKGNIQGGRIVDYLLEKNRVVRQNPGERNYHIFYALLAGLEHEEREEFYLSTPENYHYLNQSGCVEDKTISDQESFREVITAMDVMQFSKEEVREVSRLLAGILHLGNIEFITAGGAQVSFKTALGRSAELLGLDPTQLTDALTQRSMFLRGEEILTPLNVQQAVDSRDSLAMALYACCFEWVIKKINSRIKGNEDFKSIGILDIFGFENFEVNHFEQFNINYANEKLQEYFNKHIFSLEQLEYSREGLVWEDIDWIDNGECLDLIEKKLGLLALINEESHFPQATDSTLLEKLHSQHANNHFYVKPRVAVNNFGVKHYAGEVQYDVRGILEKNRDTFRDDLLNLLRESRFDFIYDLFEHVSSRNNQDTLKCGSKHRRPTVSSQFKDSLHSLMATLSSSNPFFVRCIKPNMQKMPDQFDQAVVLNQLRYSGMLETVRIRKAGYAVRRPFQDFYKRYKVLMRNLALPEDVRGKCTSLLQLYDASNSEWQLGKTKVFLRESLEQKLEKRREEEVSHAAMVIRAHVLGFLARKQYRKVLYCVVIIQKNYRAFLLRRRFL
Chain A Sequence
EEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMI
sequence length 784,784,43
structure length 784,784,43
publication title The myosin X motor is optimized for movement on actin bundles
doi rcsb
molecule tags Motor protein
molecule keywords Unconventional myosin-X
source organism Homo sapiens
pdb deposition date2016-02-04
LinkProt deposition date2016-09-13
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling