Link type | Probability | Chain J piercings | Chain S piercings | Chain T piercings | Chain W piercings | ||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
Other | 33% | -118S -144S -138T -138T | |||||||||||
view details |
![]() |
Other | 33% | -118S -144S -138T -138T | |||||||||||
view details |
![]() |
Other | 33% | -118S -144S -138T -138T | |||||||||||
view details |
![]() |
Other | 33% | -118S -144S -138T -138T | |||||||||||
view details |
![]() |
Other | 33% | -118S -144S -138T -138T | |||||||||||
view details |
![]() |
Other | 33% | -118S -144S -138T -138T | |||||||||||
view details |
![]() |
Other | 33% | -118S -144S -138T -138T | |||||||||||
view details |
![]() |
Other | 33% | -118S -144S -138T -138T | |||||||||||
view details |
![]() |
Other | 33% | -118S -144S -138T -138T | |||||||||||
view details |
![]() |
Other | 33% | -118S -144S -138T -138T | |||||||||||
view details |
![]() |
Other | 33% | -118S -144S -138T -138T | |||||||||||
view details |
![]() |
Other | 33% | -118S -144S -138T -138T | |||||||||||
view details |
![]() |
Other | 33% | -118S -144S -138T -138T | |||||||||||
view details |
![]() |
Other | 33% | -118S -144S -138T -138T | |||||||||||
view details |
![]() |
Other | 33% | -118S -144S -138T -138T | |||||||||||
view details |
![]() |
Other | 33% | -118S -144S -138T -138T | |||||||||||
view details |
![]() |
Other | 33% | -118S -144S -138T -138T | |||||||||||
view details |
![]() |
Other | 33% | -118S -144S -138T -138T | |||||||||||
view details |
![]() |
Other | 33% | -118S -144S -138T -138T | |||||||||||
view details |
![]() |
Other | 33% | -118S -144S -138T -138T | |||||||||||
view details |
![]() |
Other | 33% | -118S -144S -138T -138T | |||||||||||
view details |
![]() |
Other | 33% | -118S -144S -138T -138T | |||||||||||
view details |
![]() |
Other | 33% | -118S -144S -138T -138T | |||||||||||
view details |
![]() |
Other | 33% | -118S -144S -138T -138T | |||||||||||
view details |
![]() |
Other | 33% | -118S -144S -138T -138T | |||||||||||
view details |
![]() |
Other | 33% | -118S -144S -138T -138T | |||||||||||
view details |
![]() |
Other | 33% | -118S -144S -138T -138T | |||||||||||
view details |
![]() |
Other | 33% | -118S -144S -138T -138T | |||||||||||
view details |
![]() |
Other | 33% | -118S -144S -138T -138T | |||||||||||
view details |
![]() |
Other | 33% | -118S -144S -138T -138T | |||||||||||
view details |
![]() |
Other | 33% | -118S -144S -138T -138T | |||||||||||
view details |
![]() |
Other | 33% | -118S -144S -138T -138T | |||||||||||
view details |
![]() |
Other | 33% | -118S -144S -138T -138T | |||||||||||
view details |
![]() |
Other | 33% | -118S -144S -138T -138T |
Chain J Sequence |
LLPKRVKYRRQHRPKTTGRSKGGNYVTFGEFGLQATTTSWITSRQIESARIAMTRYMKRGGKVWIKIFPHTPYTKKPLEVRMGAGKGAVEGWIAVVKPGRILFEVAGVSEEVAREALRLASHKLPVKTKFVKREELG |
Chain J Sequence |
SLKSIIRQGKQTRSDLKQLRKSGKVPAVVYGYGTKNVSVKVDEVEFIKVIREVGRNGVIELGVGSKTIKVMVADYQFDPLKNQITHIDFLAINMSEERTVEVPVQLVGEAVGAKEGGVVEQPLFNLEVTATPDNIPEAIEVDITELNINDSLTVADVKVTGDFKIEN |
Chain J Sequence |
KNGRDSESKRLGAKRADGQFVTGGSILYRQRGTKIYPGENVGRGGDDTLFAKIDGVVKFERKGRDKKQVSVYAVA |
Chain J Sequence |
AKLQITLTRSVIGRPETQRKTVEALGLKKTNSSVVVEDNPAIRGQINKVKHLVTVEE |
sequence length | 137,167,75,57 |
structure length | 137,167,75,57 |
publication title |
The crystal structure of the large ribosomal subunit of Staphylococcus aureus in complex with lincomycin
rcsb |
molecule tags | Ribosome |
molecule keywords | 23s ribosomal RNA |
pdb deposition date | 2016-01-14 |
LinkProt deposition date | 2017-05-06 |
#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...