5HKVIKNP

The crystal structure of the large ribosomal subunit of staphylococcus aureus in complex with lincomycin
Link type Probability Chain I piercings Chain K piercings Chain N piercings Chain P piercings
view details
Other Other 34% +2P -118P -3P -39P -73P +105P +113P
view details
Other Other 34% +2P -118P -3P -39P -73P +105P +113P
view details
Other Other 34% +2P -118P -3P -39P -73P +105P +113P
view details
Other Other 34% +2P -118P -3P -39P -73P +105P +113P
view details
Other Other 34% +2P -118P -3P -39P -73P +105P +113P
view details
Other Other 34% +2P -118P -3P -39P -73P +105P +113P
view details
Other Other 34% +2P -118P -3P -39P -73P +105P +113P
view details
Other Other 34% +2P -118P -3P -39P -73P +105P +113P
view details
Other Other 34% +2P -118P -3P -39P -73P +105P +113P
view details
Other Other 34% +2P -118P -3P -39P -73P +105P +113P
view details
Other Other 34% +2P -118P -3P -39P -73P +105P +113P
view details
Other Other 34% +2P -118P -3P -39P -73P +105P +113P
view details
Other Other 34% +2P -118P -3P -39P -73P +105P +113P
view details
Other Other 34% +2P -118P -3P -39P -73P +105P +113P
view details
Other Other 34% +2P -118P -3P -39P -73P +105P +113P
view details
Other Other 34% +2P -118P -3P -39P -73P +105P +113P
view details
Other Other 34% +2P -118P -3P -39P -73P +105P +113P
view details
Other Other 34% +2P -118P -3P -39P -73P +105P +113P
view details
Other Other 34% +2P -118P -3P -39P -73P +105P +113P
view details
Other Other 34% +2P -118P -3P -39P -73P +105P +113P
view details
Other Other 34% +2P -118P -3P -39P -73P +105P +113P
view details
Other Other 34% +2P -118P -3P -39P -73P +105P +113P
Interpreting sequences
Chain I Sequence
MKLHELKPAEGSRKERNRVGRGVATGNGKTSGRGHKGQKARSGGGVRPGFEGGQLPLFRRLPKRGFTNINRKEYAIVNLDQLNKFEDGTEVTPALLVESGVVKNEKSGIKILGNGSLDKKLTVKAHKFSAS
Chain I Sequence
RKLGRTSDQRKAMLRDLATSLIISERIETTEARAKEVRSVVEKLITLGKKGDLASRRNAAKTLRNVEILNEDETTQTALQKLFGEIAERYTERQGGYTRILKQGPRRGDGAESVIIELV
Chain I Sequence
PRVKGGTVTRARRKKTIKLAKGYFGSKHTLYKVAKQQVMKSGQYAFRDRRQRKRDFRKLWITRINAAARQHEMSYSRLMNGLKKAGIDINRKMLSEIAISDEKAFAQLVTKAKDAL
Chain I Sequence
MEAKAVARTIRIAPRKVRLVLDLIRGKNAAEAIAILKLTNKASSPVIEKVLMSALANAEHNYDMNTDELVVKEAYANEGPTLKRFRPRAQGRASAINKRTSHITIVVSDGKE
sequence length 131,119,116,112
structure length 131,119,116,112
publication title The crystal structure of the large ribosomal subunit of Staphylococcus aureus in complex with lincomycin
rcsb
molecule tags Ribosome
molecule keywords 23s ribosomal RNA
pdb deposition date2016-01-14
LinkProt deposition date2017-05-06
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling